Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0122 IGR0124 IGR0120.2 IGR0123 IGR0126 IGR0121 IGR0127 IGR0125 NG0150 NG0147 rhlE, - NG0149 NG0155 fis, - NG0152 ruvC, - NG0153 tpn, - NG0146.2 NG0156 msbB, - NG0154 nifR3, - NG0151 ampN,pepN, - NG0158 NG0150 NG0147 rhlE, - NG0149 NG0155 fis, - NG0152 ruvC, - NG0153 tpn, - NG0146.2 NG0156 msbB, - NG0154 nifR3, - NG0151 ampN,pepN, - NG0158 NG0150 NG0147 rhlE, - NG0149 NG0148 NG0148 fis, - NG0152 ruvC, - NG0153 tpn, - NG0146.2 NG0156 msbB, - NG0154 nifR3, - NG0151 ampN,pepN, - NG0158 NG0155
* Calculated from Protein Sequence

Gene ID: NG0153

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ruvC  

Definition:
crossover junction endodeoxyribonuclease RuvC

Gene Start:
160778

Gene Stop:
161317

Gene Length:
540

Molecular Weight*:
18919

pI*:
10.70

Net Charge*:
8.38

EC:
3.1.22.4  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Sharples,G.J. and Lloyd,R.G.
Resolution of Holliday junctions in Escherichia coli:
identification of the ruvC gene product as a 19-kilodalton protein
J. Bacteriol. 173 (23), 7711-7715 (1991)
M:92041688

Takahagi,M., Iwasaki,H., Nakata,A. and Shinagawa,H.
Molecular analysis of the Escherichia coli ruvC gene, which encodes a Holliday junction-specific endonuclease
J. Bacteriol. 173 (18), 5747-5753 (1991)
M:91358366

Dunderdale,H.J., Benson,F.E., Parsons,C.A., Sharples,G.J.,
Lloyd,R.G. and West,S.C.
Formation and resolution of recombination intermediates by E. coli
RecA and RuvC proteins
Nature 354 (6354), 506-510 (1991)
M:92100188

Iwasaki,H., Takahagi,M., Shiba,T., Nakata,A. and Shinagawa,H.
Escherichia coli RuvC protein is an endonuclease that resolves the
Holliday structure
EMBO J. 10 (13), 4381-4389 (1991)
M:92097558

Ariyoshi,M., Vassylyev,D.G., Iwasaki,H., Nakamura,H., Shinagawa,H.
and Morikawa,K.
Atomic structure of the RuvC resolvase: a holliday
junction-specific endonuclease from E. coli
Cell 78 (6), 1063-1072 (1994)
M:95007756

West,S.C.
Processing of recombination intermediates by the RuvABC proteins
Annu. Rev. Genet. 31, 213-244 (1997)
M: 98105106



Comment:
Oklahoma ID: NGO.153

For other RUV proteins see NG0760 (ruvB) and NG1730 (ruvA).

Blast Summary:  PSI-Blast Search
NG0153 is orthologous to AE002491, N meningitidis (MC58) crossover junction endodeoxyribonuclease RuvC: residues 1-180 have 80% similarity to residues 1-180 in NG0153.

Residues 9-180 are 50% similar to RUVC_ECOLI (134125).


COGS Summary:  COGS Search
BeTs to 8 clades of COG0817
COG name: Holliday junction endodeoxyribonuclease RuvC
Functional Class:  L
The phylogenetic pattern of COG0817 is ------vce-rhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002176 (Crossover junction endodeoxyribonuclease RuvC) with a combined E-value of 1.8e-65.
    IPB002176A    9-20
    IPB002176B    61-106
    IPB002176C    107-134
    IPB002176D    135-156


ProDom Summary:  Protein Domain Search
Residues 9-156 are 40% similar to a (CROSSOVER JUNCTION ENDODEOXYRIBONUCLEASE) protein domain (PD008333) which is seen in RUVC_ECOLI.



Paralogs:  Local Blast Search


NG0153 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 156 (E-value = 1.9e-67) place NG0153 in the RuvC family which is described as Crossover junction endodeoxyribonuclease RuvC (PF02075)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
59  
180

PDB Hit:
pdb|1HJR|1HJR-A HOLLIDAY JUNCTION RESOLVASE (E.C.3.1.22.4) 109.0 4e-25

Gene Protein Sequence:
VNMSATVRILGIDPGSRVTGFGIIDVRGRDHFYVASGCIKTPADEPLADR
IAVIVRHIGEVVAVYKPQQAAVEQVFVNVNPASTLMLGQARGAALAALVS
HKLPVSEYTALQVKQAVVGKGKAAKEQVQHMVVQMLGLSGTPQADAADGL
AVALTHALRNHGLAAKLNPSGMQVKRGRFQ

Gene Nucleotide Sequence:  Sequence Viewer
GTGAATATGTCGGCAACCGTCCGTATCTTGGGCATCGACCCGGGCAGCCG
CGTAACGGGTTTCGGCATCATCGATGTCAGGGGGCGCGATCATTTTTACG
TCGCCTCCGGCTGCATCAAAACGCCTGCCGATGAGCCTCTGGCAGACAGG
ATTGCCGTGATTGTGCGGCATATCGGCGAAGTCGTTGCCGTTTACAAGCC
GCAACAGGCGGCGGTGGAACAGGTGTTCGTCAACGTCAATCCGGCATCGA
CGCTGATGCTCGGTCAGGCGCGCGGAGCGGCATTGGCGGCTTTGGTCAGC
CATAAGCTGCCCGTTTCGGAATACACGGCCTTGCAGGTCAAACAGGCGGT
GGTCGGCAAAGGCAAGGCGGCGAAAGAACAGGTGCAGCATATGGTGGTGC
AAATGCTGGGACTTTCGGGAACGCCGCAGGCGGATGCGGCGGACGGTCTT
GCCGTCGCGCTGACCCACGCCTTACGCAACCACGGGCTTGCCGCCAAACT
CAATCCTTCGGGGATGCAGGTCAAGCGCGGAAGGTTTCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy