Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0119 IGR0120.2 IGR0118 IGR0121 IGR0120 IGR0117 IGR0120.1 tpn, - NG0146.1 NG0145 NG0144 NG0147 rhlE, - NG0149 tpn, - NG0146.2 pgb, - NG0146 gluP, - NG0142 nhaC, - NG0143 tpn, - NG0146.1 NG0145 NG0144 NG0147 rhlE, - NG0149 tpn, - NG0146.2 pgb, - NG0146 gluP, - NG0142 nhaC, - NG0143 Type: inverse, Name:  - 155 Type: inverse, Name:  - 158 Type: inverse, Name:  - 184 tpn, - NG0146.1 NG0145 NG0144 NG0147 rhlE, - NG0149 NG0148 NG0148 tpn, - NG0146.2 pgb, - NG0146 gluP, - NG0142 nhaC, - NG0143
* Calculated from Protein Sequence

Gene ID: NG0146

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgb  

Definition:
porphobilinogen deaminase (hydroxymethylbilane synthase)

Gene Start:
153500

Gene Stop:
154432

Gene Length:
933

Molecular Weight*:
33600

pI*:
6.00

Net Charge*:
-4.48

EC:
4.3.1.8  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Awan SJ, Siligardi G, Shoolingin-Jordan PM, Warren MJ.
Reconstitution of the holoenzyme form of Escherichia coli porphobilinogen deaminase from apoenzyme with porphobilinogen and preuroporphyrinogen: a study using
circular dichroism spectroscopy.
Biochemistry. 1997 Jul 29;36(30):9273-82.
PMID: 9230062

Comment:
Oklahoma ID: NGO.146

Blast Summary:  PSI-Blast Search
NG0146 is orthologous to AE002409, N. meningitidis (MC58) porphobilinogen deaminase: residues 1-311 have 89% similarity to residues 1-311 in NG0146.
Residues 1-206 in NG0146 have 55% similarity to residues 1-206 in AE004938, P. aeruginosa porphobilinogen deaminase.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0181
COG name: Porphobilinogen deaminase
Functional Class:  H
The phylogenetic pattern of COG0181 is amt-yq-cebr-uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000860 (Porphobilinogen deaminase) with a combined E-value of 5e-89.
    IPB000860A    6-19
    IPB000860B    53-86
    IPB000860C    127-177
    IPB000860D    194-204
    IPB000860E    230-247


ProDom Summary:  Protein Domain Search
Residues 8-269 are 59% similar to a (PORPHOBILINOGEN DEAMINASE LYASE) protein domain (PD002745) which is seen in HEM3_PSEAE.



Paralogs:  Local Blast Search


NG0146 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 217 (E-value = 4.3e-124) place NG0146 in the Porphobil_deam family which is described as Porphobilinogen deaminase, dipyromethane cofactor binding domain (PF01379)
Residues 225 to 298 (E-value = 2.5e-17) place NG0146 in the Porphobil_deamC family which is described as Porphobilinogen deaminase, C-terminal domain (PF03900)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
155  
311

PDB Hit:
pdb|1PDA|1PDA PORPHOBILINOGEN DEAMINASE (E.C.4.3.1.8) 299.0 5e-82
pdb|1AH5|1AH5 REDUCED FORM SELENOMETHIONINE-LABELLED 296.0 3e-81
pdb|1YPN|1YPN REDUCED FORM HYDROXYMETHYLBILANE SYNTHASE (K59Q 294.0 1e-80
pdb|1PDA|1PDA PORPH

Gene Protein Sequence:
MNPKKLVIASRESLLAMWQAKHIQGRLKALYPDCEVEILGMTTRGDRILD
RTLSKVGGKGLFVKELEQSLQDGRADLAVHSIKDVPMDLPEGFALAAISE
RANPFDAFVSNRYARLEEMPEGAVVGTSSLRREAQLRARYPHLVIKPLRG
NVQTRLSKLDNGEYDAIILAAAGLQRLELDERIRMILSESDSLPAAGQGA
LGIEIATHREDLYEVLKPLNHDTTHACVTAERALARALGGSCQVPLAAYC
TEENGLLILRGLVGHPDGSIVLQADAQAPAGYADALGRAVAKKLADDGAQ
ELIGAVLNTEN

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCCGAAAAAACTTGTTATCGCCAGCCGCGAAAGCCTGCTTGCCAT
GTGGCAGGCGAAACATATCCAAGGCCGTCTGAAGGCGCTGTATCCCGATT
GCGAAGTCGAAATTTTGGGCATGACCACGCGCGGCGACCGGATTTTGGAC
AGAACTTTGTCAAAAGTCGGCGGGAAAGGCTTGTTTGTCAAAGAGTTGGA
ACAATCCCTTCAAGACGGGCGCGCCGATTTGGCGGTGCATTCGATTAAGG
ACGTGCCGATGGATTTGCCCGAAGGCTTCGCCCTTGCCGCCATCAGCGAA
CGCGCCAATCCGTTTGACGCGTTTGTGTCCAACCGATACGCGCGTTTGGA
AGAAATGCCCGAAGGCGCGGTTGTCGGCACATCCAGCCTGCGCCGCGAAG
CCCAGTTGCGCGCGCGCTATCCGCATTTGGTAATTAAACCCCTGCGCGGC
AATGTACAAACCCGTTTGTCCAAACTCGACAACGGCGAATACGATGCAAT
TATCTTGGCTGCCGCCGGGTTGCAGCGTCTGGAATTGGATGAACGCATCC
GCATGATTTTGTCGGAATCCGACAGCCTGCCTGCCGCCGGACAAGGCGCA
TTGGGTATTGAAATTGCCACGCATCGCGAAGATTTGTACGAAGTCTTGAA
GCCGTTAAACCACGATACCACACACGCCTGCGTTACCGCCGAACGCGCTT
TGGCGCGCGCTTTGGGCGGAAGCTGCCAAGTGCCGCTGGCCGCGTATTGC
ACTGAAGAAAACGGGCTGCTGATCTTGCGCGGATTGGTCGGGCATCCCGA
CGGATCGATTGTGTTGCAGGCGGACGCGCAAGCCCCTGCCGGATATGCCG
ATGCGCTTGGACGTGCGGTTGCCAAAAAACTGGCGGACGACGGTGCGCAG
GAATTGATTGGAGCAGTATTGAATACGGAAAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy