Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 IGR0115 IGR0111 IGR0112 IGR0114 IGR0110 IGR0116 IGR0113 IGR0118 IGR0117 IGR0108 NG0140 end3, - NG0139 NG0144 hex2, - NG0135 mucD, - NG0138 NG0136 NG0141 NG0137 gluP, - NG0142 nhaC, - NG0143 NG0140 end3, - NG0139 NG0144 hex2, - NG0135 mucD, - NG0138 NG0136 NG0141 NG0137 gluP, - NG0142 nhaC, - NG0143 NG0140 end3, - NG0139 NG0144 hex2, - NG0135 mucD, - NG0138 NG0136 NG0141 NG0137 gluP, - NG0142 nhaC, - NG0143
* Calculated from Protein Sequence

Gene ID: NG0139

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
end3  

Definition:
endonuclease III

Gene Start:
148109

Gene Stop:
147483

Gene Length:
627

Molecular Weight*:
23608

pI*:
8.60

Net Charge*:
5.44

EC:
4.2.99.18  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table

Secondary Evidence:
Matsumoto Y, Zhang QM, Takao M, Yasui A, Yonei S.
Escherichia coli Nth and human hNTH1 DNA glycosylases are involved in removal of 8-oxoguanine from 8-oxoguanine/guanine mispairs in DNA.
Nucleic Acids Res. 2001 May 1;29(9):1975-1981.
PMID: 11328882


Venkhataraman R, Donald CD, Roy R, You HJ, Doetsch PW, Kow YW.
Enzymatic processing of DNA containing tandem dihydrouracil by endonucleases III and VIII.
Nucleic Acids Res. 2001 Jan 15;29(2):407-14.
PMID: 11139610

Comment:
Oklahoma ID: NGO.139c

Blast Summary:  PSI-Blast Search
NG0139 is orthologous to AE002409, N. meningitidis MC58 endonuclease III: residues 1-209 have 98% similarity to 1-209 in NG0139.


COGS Summary:  COGS Search
BeTs to 16 clades of COG0177
COG name: Predicted EndoIII-related endonuclease
Functional Class:  L
The phylogenetic pattern of COG0177 is amtkYQvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001502 (Endonuclease III) with a combined E-value of 9.8e-77.
    IPB001502A    33-54
    IPB001502B    72-86
    IPB001502C    100-131
    IPB001502D    137-163
    IPB001502E    176-203


ProDom Summary:  Protein Domain Search
Residues 37-208 are 71% similar to a (ENDONUCLEASE III DNA HYDROLASE) protein domain (PD001558) which is seen in END3_ECOLI.

Residues 1-36 are 72% similar to a (ENDONUCLEASE III DNA-APURINIC OR) protein domain (PD035528) which is seen in END3_ECOLI.



Paralogs:  Local Blast Search


NG0139 is paralogously related to NG0710 (A/G-specific adenine glycosylase) (3e-08).


Pfam Summary:  Pfam Search
Residues 34 to 169 (E-value = 2e-14) place NG0139 in the HhH-GPD family which is described as HhH-GPD superfamily base excision DNA repair protein (PF00730)
Residues 99 to 128 (E-value = 1e-06) place NG0139 in the HHH family which is described as Helix-hairpin-helix motif (PF00633)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|2ABK|2ABK REFINEMENT OF THE NATIVE STRUCTURE OF 316.0 3e-87
pdb|1KEA|1KEA-A STRUCTURE OF A THERMOSTABLE THYMINE-DNA 75.3 9e-15
pdb|1KG4|1KG4-A CRYSTAL STRUCTURE OF THE K142A MUTANT OF E. COLI 55.0 1e-08
pdb|1KG2|1KG2-A CRYS

Gene Protein Sequence:
MNRQIRQEIFERFRAANPHPTTELNFNSPFELLIAVLLSAQATDVGVNKA
TAKLFPVADTPQAMLDLGLDGVMEYTKTIGLYKTKSKHIMQTCRIVLEKY
NGQVPEDREALESLPGVGRKTANVVLNTAFGHPVMAVDTHIFRVSNRTKI
APGKDVREVEDKLMRFIPKEFLMDAHHWLILHGRYTCKALKPQCQTCIIN
DLCEYPAKS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACAGACAAATCCGCCAAGAAATCTTCGAGCGTTTCCGCGCCGCCAA
CCCCCATCCGACCACCGAGCTGAATTTCAACTCCCCTTTCGAGCTTTTAA
TCGCCGTTCTGCTTTCGGCGCAGGCGACCGATGTCGGCGTAAACAAGGCG
ACGGCGAAGCTGTTTCCGGTTGCCGATACGCCGCAGGCGATGCTGGATTT
GGGCTTGGACGGCGTGATGGAATACACGAAAACCATCGGGCTGTATAAAA
CCAAGTCCAAACACATTATGCAAACCTGCCGCATCGTGCTGGAAAAATAC
AACGGCCAAGTGCCGGAAGACCGCGAGGCTTTGGAATCGTTGCCTGGCGT
GGGGCGCAAAACGGCAAACGTGGTATTGAACACAGCGTTCGGACACCCCG
TTATGGCGGTCGATACGCATATTTTCCGCGTGTCCAACCGAACCAAAATC
GCACCCGGAAAAGATGTACGCGAAGTCGAAGACAAACTGATGCGCTTCAT
TCCTAAAGAATTTCTGATGGACGCGCACCACTGGCTGATTTTGCACGGAC
GCTACACCTGCAAGGCTTTAAAGCCGCAATGCCAAACCTGCATCATCAAC
GATTTGTGCGAATATCCCGCCAAATCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy