Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 IGR0115 IGR0111 IGR0112 IGR0114 IGR0110 IGR0116 IGR0113 IGR0117 IGR0108 NG0140 end3, - NG0139 hex2, - NG0135 mucD, - NG0138 NG0136 NG0141 NG0137 NG0132 gluP, - NG0142 nhaC, - NG0143 NG0140 end3, - NG0139 hex2, - NG0135 mucD, - NG0138 NG0136 NG0141 NG0137 NG0132 gluP, - NG0142 nhaC, - NG0143 NG0140 end3, - NG0139 hex2, - NG0135 mucD, - NG0138 NG0136 NG0141 NG0137 NG0132 gluP, - NG0142 nhaC, - NG0143
* Calculated from Protein Sequence

Gene ID: NG0138

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mucD  

Definition:
serine protease MucD

Gene Start:
147342

Gene Stop:
145846

Gene Length:
1497

Molecular Weight*:
52525

pI*:
5.20

Net Charge*:
-7.85

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.138c

Blast Summary:  PSI-Blast Search
NG0138 is orthologous to AL162754, N. meningitidis (Z2491) putative periplasmic serine protease: residues 1-499 have 94% similarity to residues 1-499 in NG0138.
Residues 54-498 have 49% similarity to AF343973, P. aeruginosa MucD protein.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0265
COG name: Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain
Functional Class:  O
The phylogenetic pattern of COG0265 is --t-yqvCEBRHuj--oLinX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000126 (Serine proteases, V8 family) with a combined E-value of 8.4e-12.
    IPB000126A    126-141
    IPB000126B    236-252
    IPB000126A    127-142


ProDom Summary:  Protein Domain Search
Residues 195-309 are 83% similar to a (PROTEASE SERINE PROTEIN PERIPLASMIC) protein domain (PD001397) which is seen in Q57155_PSEAE.

Residues 126-191 are 60% similar to a (PROTEASE SERINE PROTEIN PERIPLASMIC) protein domain (PD001340) which is seen in Q57155_PSEAE.

Residues 323-377 are 50% similar to a (PROTEIN DOMAIN PROTEASE PDZ) protein domain (PD000073) which is seen in Q44476_AZOVI.



Paralogs:  Local Blast Search


NG0138 is paralogously related to NG1800 (conserved hypothetical protein (possible integral membrane protein)) (1e-04).


Pfam Summary:  Pfam Search
Residues 112 to 287 (E-value = 3.9e-20) place NG0138 in the Trypsin family which is described as Trypsin (PF00089)
Residues 288 to 378 (E-value = 1.7e-08) place NG0138 in the PDZ family which is described as PDZ domain (Also known as DHR or GLGF) (PF00595)

Structural Feature(s):
Feature Type  Start  Stop
may be a lipoprotein  
  
transmembrane  
271  
287
non-globular  
287  
395

PDB Hit:
pdb|1KY9|1KY9-A CRYSTAL STRUCTURE OF DEGP (HTRA) 245.0 2e-65
pdb|1LCY|1LCY-A CRYSTAL STRUCTURE OF THE MITOCHONDRIAL SERINE 151.0 2e-37
pdb|1KY9|1KY9-A CRYSTAL STRUCTURE OF DEGP (HTRA) 550.0 0e+00
pdb|1LCY|1LCY-A CRYS

Gene Protein Sequence:
VFKKYQYFALAALCAALLAGCEKAGSFFGADKKEASFVERIEHTKDDGSV
SMLLPDFAQLVQSEGPAVVNIQAAPAPRTQNGSGNAETDSDPLADSDPFY
EFFKRLVPNMPEIPQEEADDGGLNFGSGFIISKNGYILTNTHVVAGMGSI
KVLLNDKREYTAKLIGSDVQSDVALLKIDATEELPVVKIGNPKNLKPGEW
VAAIGAPFGFDNSVTAGIVSAKGRSLPNESYTPFIQTDVAINPGNSGGPL
FNLKGQVVGINSQIYSRSGGFMGISFAIPIDVAMNVAEQLKNTGKVQRGQ
LGVIIQEVSYGLAQSFGLDKASGALIAKILPGSPAERAGLQAGDIVLSLD
GGEIRSSGDLPVMVGAITPGKEVSLGVWRKGEEITIKAKLGNAAEHTGAS
SKTDEAPYTEQQSGTFSVESAGITLQTHTDSSGKHLVVVRVSDAAERAGL
RRGDEILAVGQVPVNDEAGFRKAMDKAGKNVPLLVMRRGNTLFIALNLQ

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTCAAAAAATACCAATACTTCGCTTTGGCGGCACTGTGTGCCGCCTT
GCTGGCAGGCTGCGAAAAGGCAGGCAGCTTTTTCGGTGCGGACAAAAAAG
AAGCATCCTTCGTAGAACGCATCGAACACACCAAAGACGACGGCAGTGTC
AGTATGCTGCTGCCCGACTTTGCCCAACTGGTTCAAAGCGAAGGCCCGGC
AGTCGTCAATATTCAGGCAGCCCCCGCCCCGCGCACCCAAAACGGCAGCG
GCAATGCCGAAACCGATTCCGACCCGCTTGCCGACAGCGACCCGTTCTAC
GAATTTTTCAAACGCCTCGTCCCGAACATGCCCGAAATCCCCCAAGAAGA
AGCAGATGACGGCGGATTGAACTTCGGTTCGGGCTTCATCATCAGCAAAA
ACGGCTACATCCTGACCAATACCCACGTCGTTGCCGGTATGGGCAGTATC
AAAGTCCTGCTCAACGACAAGCGCGAATATACCGCCAAACTCATCGGTTC
GGATGTCCAATCCGATGTCGCCCTTCTGAAAATCGACGCAACGGAAGAGC
TACCCGTCGTCAAAATCGGCAATCCCAAAAATTTGAAACCGGGCGAATGG
GTCGCTGCCATCGGCGCGCCCTTCGGCTTTGACAACAGCGTGACCGCCGG
CATCGTGTCCGCCAAAGGCAGAAGCCTGCCCAACGAAAGCTACACACCCT
TCATCCAAACCGACGTTGCCATCAATCCGGGCAATTCCGGCGGCCCGCTG
TTCAACTTAAAAGGACAGGTCGTCGGCATCAATTCGCAAATATACAGCCG
CAGCGGCGGATTCATGGGCATCTCCTTTGCCATCCCGATTGACGTTGCCA
TGAATGTCGCCGAACAGCTGAAAAACACCGGCAAAGTCCAACGCGGACAA
CTGGGCGTGATTATTCAGGAAGTATCCTACGGTTTGGCACAGTCGTTCGG
TCTGGATAAAGCCAGCGGCGCATTGATTGCCAAAATCCTTCCCGGCAGCC
CCGCAGAACGTGCCGGCCTGCAGGCGGGCGACATCGTCCTCAGCCTCGAC
GGCGGAGAAATACGTTCTTCCGGCGACCTTCCCGTCATGGTCGGCGCCAT
TACGCCGGGAAAAGAAGTCAGCCTCGGCGTATGGCGCAAAGGCGAAGAAA
TCACAATCAAAGCCAAGCTGGGCAACGCCGCCGAGCATACCGGCGCATCA
TCCAAAACAGATGAAGCCCCCTACACCGAACAGCAATCCGGTACGTTCTC
GGTCGAATCCGCAGGCATTACCCTTCAGACACATACCGACAGCAGCGGCA
AACACCTCGTCGTCGTACGGGTTTCCGACGCGGCAGAACGCGCAGGCTTA
AGGCGCGGCGACGAAATCCTCGCGGTCGGGCAAGTCCCCGTCAATGACGA
AGCCGGTTTCCGCAAAGCTATGGACAAGGCAGGCAAAAACGTCCCCCTGC
TGGTCATGCGCCGTGGCAACACGCTGTTCATCGCATTAAACCTGCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy