Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 IGR0104 IGR0111 IGR0105 IGR0112 IGR0114 IGR0110 IGR0106 IGR0103 IGR0113 IGR0107 IGR0108 NG0140 end3, - NG0139 hex2, - NG0135 rbn, - NG0127 mucD, - NG0138 NG0136 NG0137 wrbA, - NG0128 ptpS,ygcM, - NG0131 NG0130 ybaX, - NG0129 NG0132 NG0140 end3, - NG0139 hex2, - NG0135 rbn, - NG0127 mucD, - NG0138 NG0136 NG0137 wrbA, - NG0128 ptpS,ygcM, - NG0131 NG0130 ybaX, - NG0129 NG0132 Type: tandem, Name:  - 11 end3, - NG0139 hex2, - NG0135 rbn, - NG0127 mucD, - NG0138 NG0136 NG0140 NG0137 wrbA, - NG0128 ptpS,ygcM, - NG0131 NG0130 ybaX, - NG0129 NG0132
* Calculated from Protein Sequence

Gene ID: NG0135

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hex2  

Definition:
beta-N-acetyl-D-glucosaminidase

Gene Start:
144063

Gene Stop:
142981

Gene Length:
1083

Molecular Weight*:
39020

pI*:
5.20

Net Charge*:
-9.33

EC:
3.2.1.52  

Functional Class:
Central intermediary metabolism; Amino sugars  

Pathway: pathway table
Aminosugars metabolism
Glycoprotein degradation
Glycosaminoglycan degradation
Sphingoglycolipid metabolism

Comment:
Oklahoma ID: NGO.135c

Blast Summary:  PSI-Blast Search
NG0135 is orthologous to AL162754, N. meningitidis (Z2491) probable beta-N-acetylhexosaminidase: residues 1-361 have 89% similarity to residues 1-361 in NG0135.

Residues 8-290 are 49% similar to the beta-N-acetyl-D-glucosaminidase from P.aeruginosa (11347508).




COGS Summary:  COGS Search
BeTs to 7 clades of COG1472
COG name: Beta-glucosidase-related glycosidases
Functional Class:  G
The phylogenetic pattern of COG1472 is ------VcEbRh----O---x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001764 (Glycoside hydrolase family 3, N terminal) with a combined E-value of 2.5e-19.
    IPB001764A    168-182
    IPB001764B    244-259
    IPB001764C    273-296


ProDom Summary:  Protein Domain Search
Residues 253-321 are 41% similar to a (HYDROLASE GLYCOSIDASE PROTEIN) protein domain (PD041139) which is seen in HEX2_VIBFU.

Residues 12-251 are 41% similar to a (HYDROLASE GLYCOSIDASE BETA-GLUCOSIDASE CELLOBIASE) protein domain (PD001132) which is seen in YCFO_ECOLI.



Paralogs:  Local Blast Search


NG0135 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 61 to 288 (E-value = 1.1e-48) place NG0135 in the Glyco_hydro_3 family which is described as Glycosyl hydrolase family 3 N terminal domain (PF00933)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTVPHIPRGPVMADIAAFRLTEEEKQRLLDPAIGGIILFRRNFQNIEQLK
TLTAEIKALRTPELIIAVDHEGGRVQRFIEGFTRLPAMNVLGQIWDKDGA
SAAETAAGQVGRVLATELSACGIDLSFTPVLDLDWGNCAVIGNRSFHRNP
EAVARLALALQKGLAKGGMKSCGKHFPGHGFVEGDSHLVLPEDGRSLDEL
EAADLAPFRIMSREGMAAVMPAHVVYPQVDTKPAGFSEIWLKQILRRDIG
FKGVIFSDDLTMEGACGAGGIKERARISFEAGCDIVLVCNRPDLVDELRD
GFTIPDNQDLAGRWQYMENSLGHEAVQAVMQTMGFQAAQAFVAGLASPQD
TAGGVKVGEAF

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGTCCCCCATATTCCGCGCGGCCCCGTCATGGCAGACATTGCCGC
CTTCCGCCTGACCGAAGAAGAAAAACAACGCCTGCTCGATCCCGCAATCG
GCGGCATCATCCTCTTCCGCCGCAACTTCCAAAACATCGAACAACTCAAA
ACACTCACCGCCGAAATCAAAGCCCTGCGCACACCCGAACTCATTATCGC
CGTCGATCACGAAGGCGGCAGGGTGCAACGTTTCATCGAAGGTTTTACCC
GCCTGCCCGCAATGAACGTTTTAGGGCAAATTTGGGACAAAGACGGCGCG
TCCGCCGCCGAAACCGCTGCCGGACAAGTCGGCCGGGTTTTGGCAACCGA
GCTTTCCGCCTGCGGCATCGATTTGTCCTTCACGCCCGTCTTAGATTTGG
ACTGGGGAAACTGCGCCGTCATCGGCAACCGCAGCTTCCACCGCAATCCC
GAAGCGGTCGCCCGCCTCGCCCTCGCCCTTCAAAAAGGTTTGGCAAAAGG
CGGTATGAAATCATGCGGCAAACATTTTCCCGGACACGGATTTGTCGAAG
GGGACAGCCATTTGGTGCTACCCGAAGACGGGCGCAGCCTCGACGAACTC
GAAGCCGCCGACCTCGCCCCCTTCCGCATTATGAGCCGCGAAGGTATGGC
GGCGGTCATGCCCGCCCACGTCGTTTATCCGCAAGTGGACACAAAGCCCG
CAGGGTTTTCCGAAATCTGGCTCAAACAAATTTTGCGCCGCGATATCGGA
TTCAAAGGCGTGATTTTTTCTGACGATTTGACCATGGAGGGCGCGTGCGG
GGCAGGCGGCATCAAAGAACGCGCCCGCATTTCCTTTGAGGCAGGTTGCG
ACATCGTCCTCGTCTGCAACCGTCCCGACTTGGTCGATGAATTGCGCGAC
GGTTTCACCATTCCCGACAACCAGGATTTGGCCGGACGTTGGCAATACAT
GGAAAACTCGCTCGGTCATGAGGCGGTACAAGCCGTTATGCAGACAATGG
GTTTCCAAGCGGCGCAAGCCTTTGTTGCCGGCCTTGCCTCGCCGCAGGAC
ACGGCGGGCGGCGTAAAAGTCGGAGAGGCCTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy