Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 IGR0104 IGR0101 IGR0111 IGR0105 IGR0112 IGR0110 IGR0106 IGR0103 IGR0102 IGR0107 IGR0102.1 IGR0108 hex2, - NG0135 rbn, - NG0127 mucD, - NG0138 NG0136 NG0137 NG0125 NG0124 wrbA, - NG0128 ptpS,ygcM, - NG0131 NG0130 ybaX, - NG0129 NG0126 NG0132 hex2, - NG0135 rbn, - NG0127 mucD, - NG0138 NG0136 NG0137 NG0125 NG0124 wrbA, - NG0128 ptpS,ygcM, - NG0131 NG0130 ybaX, - NG0129 NG0126 NG0132 Type: tandem, Name:  - 10 Type: tandem, Name:  - 11 hex2, - NG0135 rbn, - NG0127 mucD, - NG0138 NG0136 NG0137 wrbA, - NG0128 ptpS,ygcM, - NG0131 NG0130 ybaX, - NG0129 NG0126 NG0132 NG0124 NG0125
* Calculated from Protein Sequence

Gene ID: NG0131

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptpS  ygcM  

Definition:
6-pyruvoyl tetrahydrobiopterin synthase/PTP synthase

Gene Start:
140790

Gene Stop:
141209

Gene Length:
420

Molecular Weight*:
15733

pI*:
6.90

Net Charge*:
-0.56

EC:
4.2.3.12  4.6.1.10  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table
Folate biosynthesis

Secondary Evidence:
Nar H, Huber R, Heizmann CW, Thony B,Burgisser D.
Three-dimensional structure of 6-pyruvoyl tetrahydropterin synthase, an enzyme involved in tetrahydrobiopterin biosynthesis.
EMBO J. 1994 Mar 15;13(6):1255-62.
PMID: 8137809

Comment:
Oklahoma ID: NGO.131

Blast Summary:  PSI-Blast Search
NG0131 is orthologous to AE002408, N. meningitidis (MC586) putative 6-pyruvoyl tetrahydrobiopterin synthase: residues 1-140 have 95% similarity to residues 1-140 in NG0131.

Residues 2-138 have 57% similarity to residues 3-140 in U32798, H. influenzae (Rd) putative 6-pyruvoyl tetrahydrobiopterin synthase.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0720
COG name: 6-pyruvoyl-tetrahydropterin synthase
Functional Class:  H
The phylogenetic pattern of COG0720 is amtK-Qvceb-huj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001914 (6-pyruvoyl tetrahydropterin synthase) with a combined E-value of 2.3e-29.
    IPB001914A    8-17
    IPB001914B    20-34
    IPB001914C    103-113
    IPB001914D    122-139


ProDom Summary:  Protein Domain Search
Residues 2-138 are 57% similar to a (PROTEIN SYNTHASE LYASE) protein domain (PD004049) which is seen in YB90_HAEIN.



Paralogs:  Local Blast Search


NG0131 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 140 (E-value = 5.2e-07) place NG0131 in the PTPS family which is described as 6-pyruvoyl tetrahydropterin synthase (PF01242)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PBD database.

Gene Protein Sequence:
MKITKIFTFDSSHMLDGHDGKCQNLHGHTYKLEITVSDGIVRGGPKDGMV
MDFTDLKAIVKQHITDPFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPC
RTTAENMAVEMYCRLKNAGLNVCRVKLWETPTSCAEYEGE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTACCAAGATATTTACCTTCGACTCCTCGCATATGCTCGACGG
GCATGACGGCAAATGCCAAAACCTGCACGGACATACCTACAAACTCGAAA
TCACCGTTTCAGACGGCATCGTCAGGGGCGGGCCGAAAGACGGAATGGTG
ATGGATTTCACCGACCTCAAAGCCATTGTAAAACAACACATTACCGATCC
CTTCGATCACGCCTTCATCTACCACGGCGGCAATGGCCGCGAATCTCAAA
TCGCCGCGCTCTTGGAGGGCTGGAACATGAAAACCCTGCGCCTGCCCTGC
CGCACAACTGCCGAAAATATGGCGGTCGAAATGTACTGCCGTCTGAAAAA
CGCGGGGCTGAACGTGTGCCGCGTCAAATTGTGGGAAACGCCGACATCGT
GCGCGGAGTATGAAGGGGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy