Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0093 IGR0101 IGR0096 IGR0099 IGR0094 IGR0097 IGR0102 IGR0098 IGR0100 IGR0092 IGR0095 NG0119 NG0115 argC, - NG0118 rng,cafA, - NG0113 NG0120 NG0125 glr3,grx3, - NG0114 NG0124 NG0122 secB, - NG0116 NG0126 NG0121 cvaA, - NG0123 recG, - NG0117 NG0119 NG0115 argC, - NG0118 rng,cafA, - NG0113 NG0120 NG0125 glr3,grx3, - NG0114 NG0124 NG0122 secB, - NG0116 NG0126 NG0121 cvaA, - NG0123 recG, - NG0117 NG0119 NG0115 argC, - NG0118 rng,cafA, - NG0113 NG0120 NG0122 secB, - NG0116 NG0126 NG0121 cvaA, - NG0123 recG, - NG0117 glr3,grx3, - NG0114 NG0124 NG0125
* Calculated from Protein Sequence

Gene ID: NG0118

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
argC  

Definition:
N-acetyl-gamma-glutamyl-phosphate reductase (ArgC)

Gene Start:
132033

Gene Stop:
130993

Gene Length:
1041

Molecular Weight*:
37163

pI*:
6.40

Net Charge*:
-3.16

EC:
1.2.1.38  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Urea cycle and metabolism of amino groups

Secondary Evidence:
Parsot,C., Boyen,A., Cohen,G.N. and Glansdorff,N.
Nucleotide sequence of Escherichia coli argB and argC genes:
comparison of N-acetylglutamate kinase and
N-acetylglutamate-gamma-semialdehyde dehydrogenase with homologous
and analogous enzymes
Gene 68 (2), 275-283 (1988)
M:89121510


Comment:
See also: ArgA, NG0027; ArgB, NG0844; ArgD, NG0646; ArgF, NG1232; ArgG, NG1961; ArgH, NG0219, ArgJ, NG1194.

Oklahoma ID: NGO.118c

Blast Summary:  PSI-Blast Search
NG0118 is orthologous to AE002528, N. meningitidis (MC58) N-acetyl-gamma-glutamyl-phosphate reductase : residues 1-347 of both proteins have 97% similarity.

Residues 5-347 are 59% similar to the enzyme from P.aeruginosa (11350624).


COGS Summary:  COGS Search
BeTs to 11 clades of COG0002
COG name: Acetylglutamate semialdehyde dehydrogenase
Functional Class:  E
The phylogenetic pattern of COG0002 is amtkyqvcebr----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000706 (N-acetyl-gamma-glutamyl-phosphate reductase, active site) with a combined E-value of 8.6e-110.
    IPB000706A    7-28
    IPB000706B    74-83
    IPB000706C    97-116
    IPB000706D    131-146
    IPB000706E    147-164
    IPB000706F    180-192
    IPB000706G    207-218
    IPB000706H    235-249
    IPB000706I    307-340
***** IPB000534 (Semialdehyde dehydrogenase) with a combined E-value of 1.2e-17.
    IPB000534A    147-164
    IPB000534B    314-326
***** IPB000319 (Aspartate-semialdehyde dehydrogenase) with a combined E-value of 1e-07.
    IPB000319A    7-18
    IPB000319I    314-328


ProDom Summary:  Protein Domain Search
Residues 130-340 are 48% similar to a (REDUCTASE) protein domain (PD003765) which is seen in O82187_ARATH.

Residues 5-136 are 30% similar to a (N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE EC 1.2.1.38) protein domain (PD119145) which is seen in ARGC_LACPL.

Residues 5-106 are 48% similar to a (DEHYDROGENASE OXIDOREDUCTASE BIOSYNTHESIS NADP) protein domain (PD001262) which is seen in O28208_ARCFU.



Paralogs:  Local Blast Search


NG0118 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 148 (E-value = 1.9e-39) place NG0118 in the Semialdhyde_dh family which is described as Semialdehyde dehydrogenase, NAD binding domain (PF01118)
Residues 161 to 318 (E-value = 4.2e-15) place NG0118 in the Semialdhyde_dhC family which is described as Semialdehyde dehydrogenase, dimerisation domain (PF02774)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSKKIKAGIVGATGYTGVELLRLLAAHPDVEVAAVTSRSEAGTAVADYFP
SLRGVYGLAFQTPDEAGLEQCDIVFFATPNGIAMKDAPRLLEQGVRVIDL
SADFRIRDIPTWEHWYGMTHAAPGLVSQAVYGLSELNREAVAQARLVANP
GCYPTCVSLPLVPLLRQCRLKPGMPLIADCKSGVSGAGRKGNVGSLLCEA
GDNFKAYGTAGHRHLPEIRQTIAGLQDGIAEGFVFTPHLAPMIRGMHATV
YLHLSDGSDPETVLRDYYRDSPFMDILPAGSTPETRSVRGANLCRISIRQ
AAQSDVWVVLSVIDNLVKGAAGQAVQNMNIMFGLEETHGLDAIPLLP

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAAAAAAATCAAAGCCGGCATTGTCGGCGCGACGGGCTACACGGG
CGTGGAACTGCTGCGCCTGCTTGCCGCCCATCCAGATGTCGAAGTTGCCG
CCGTAACCAGCCGCAGCGAAGCGGGAACCGCAGTTGCCGATTACTTTCCA
AGTCTGCGCGGCGTGTACGGCCTCGCCTTCCAAACACCCGACGAGGCAGG
TTTGGAACAATGCGACATCGTCTTCTTCGCCACGCCCAACGGCATCGCCA
TGAAAGACGCGCCACGCCTTTTGGAACAGGGCGTGCGCGTCATCGACCTT
TCCGCCGACTTCCGCATACGGGACATTCCGACCTGGGAACACTGGTACGG
CATGACTCACGCCGCCCCCGGCCTCGTTTCCCAAGCCGTGTACGGATTGA
GCGAACTCAACCGCGAAGCCGTCGCACAGGCGCGCCTCGTCGCCAACCCC
GGCTGCTACCCGACCTGCGTATCCCTGCCGCTCGTGCCGCTGTTGCGGCA
ATGCCGTCTGAAGCCCGGTATGCCGCTGATTGCCGACTGCAAATCCGGCG
TGTCCGGCGCGGGCAGGAAAGGCAATGTCGGTTCGCTGTTGTGCGAAGCC
GGCGACAACTTCAAAGCCTACGGCACAGCCGGACACCGCCACCTGCCCGA
AATCAGGCAGACCATCGCCGGGCTTCAGGACGGCATCGCCGAAGGATTCG
TGTTCACGCCGCACCTCGCGCCGATGATACGCGGTATGCACGCCACCGTT
TACCTCCACCTTTCAGACGGCAGCGACCCCGAAACCGTCCTGCGCGACTA
CTACCGCGACAGCCCGTTCATGGACATCCTGCCCGCCGGTTCGACACCCG
AAACCCGCAGCGTGCGCGGCGCAAACCTCTGCCGCATCAGCATCCGTCAG
GCGGCGCAATCCGATGTGTGGGTCGTCCTTTCCGTCATCGACAACCTCGT
CAAAGGCGCGGCGGGTCAGGCAGTCCAAAATATGAACATTATGTTCGGAC
TGGAGGAAACACACGGCTTGGACGCAATCCCCCTGCTCCCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy