Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0093 IGR0096 IGR0091 IGR0099 IGR0094 IGR0097 IGR0090.1 IGR0098 IGR0092 IGR0095 NG0119 NG0115 argC, - NG0118 rng,cafA, - NG0113 NG0120 glr3,grx3, - NG0114 NG0122 secB, - NG0116 basR, - NG0111 NG0121 basS, - NG0112 cvaA, - NG0123 recG, - NG0117 NG0119 NG0115 argC, - NG0118 rng,cafA, - NG0113 NG0120 glr3,grx3, - NG0114 NG0122 secB, - NG0116 basR, - NG0111 NG0121 basS, - NG0112 cvaA, - NG0123 recG, - NG0117 NG0119 NG0115 argC, - NG0118 rng,cafA, - NG0113 NG0120 secB, - NG0116 basR, - NG0111 NG0121 basS, - NG0112 cvaA, - NG0123 recG, - NG0117 glr3,grx3, - NG0114 NG0122
* Calculated from Protein Sequence

Gene ID: NG0117

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recG  

Definition:
DNA helicase (RecG)

Gene Start:
128354

Gene Stop:
130393

Gene Length:
2040

Molecular Weight*:
74830

pI*:
7.90

Net Charge*:
6.56

EC:
3.6.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Secondary Evidence:
Lombardo MJ, Rosenberg SM.
radC102 of Escherichia coli is an allele of recG.
J Bacteriol. 2000 Nov;182(22):6287-91.
PMID: 11053371

Ochsner UA, Vasil ML, Alsabbagh E, Parvatiyar K, Hassett DJ.
Role of the Pseudomonas aeruginosa oxyR-recG operon in oxidative stress defense and DNA repair: OxyR-dependent regulation of katB-ankB, ahpB, and ahpC-ahpF.
J Bacteriol. 2000 Aug;182(16):4533-44.
PMID: 10913087

Comment:
Oklahoma ID: NGO.117

For other 'rec' genes, see NG0318 (recN), NG0370 (recB), NG0414 (recJ), NG0741 (recA), NG0767 (recR), NG0771 (recD), NG1053 (recX), NG1369 (recC), NG1509 (recO), NG1722 (recQ).

Blast Summary:  PSI-Blast Search
NG0117 is orthologous to AL162753, N. meningitidis Z2491 ATP-dependent DNA helicase RecG : residues 1-680 in both proteins have 93% similarity.

Residues 17-677 are 52% similar to the predicted recG from E.coli (13364002).

COGS Summary:  COGS Search
BeTs to 9 clades of COG1200
COG name: RecG-like helicases
Functional Class:  L,K
The phylogenetic pattern of COG1200 is -----qvcebrhuj--ol--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 257-340 are 66% similar to a (HELICASE ATP-BINDING RNA-BINDING PROTEIN RNA) protein domain (PD000085) which is seen in RECG_THIFE.

Residues 17-232 are 46% similar to a (DNA HELICASE ATP-DEPENDENT RECG REPAIR ATP-BINDING) protein domain (PD006348) which is seen in RECG_ECOLI.

Residues 491-585 are 62% similar to a (HELICASE PROTEIN POLYPROTEIN ATP-BINDING RNA RNA-BINDING) protein domain (PD000033) which is seen in RECG_ECOLI.

Residues 469-649 are 31% similar to a (ATP-DEPENDENT DNA HELICASE RECG) protein domain (PD099794) which is seen in RECG_HELPY.

Residues 362-459 are 59% similar to a (HELICASE DNA REPAIR ATP-BINDING) protein domain (PD003500) which is seen in RECG_ECOLI.



Paralogs:  Local Blast Search


NG0117 is paralogously related to NG0623 (transcription-repair coupling factor Mfd) (2e-72), NG0149 (ATP-dependent RNA helicase RhlE) (8e-08), NG0650 (ATP-dependent RNA helicase) (3e-05), NG1437 (primosomal protein N' (replication factor Y)) (5e-05) and NG0573 (excinuclease ABC, subunit B (uvrB)) (8e-05).


Pfam Summary:  Pfam Search
Residues 251 to 447 (E-value = 4.3e-29) place NG0117 in the DEAD family which is described as DEAD/DEAH box helicase (PF00270)
Residues 501 to 576 (E-value = 3e-19) place NG0117 in the Helicase_C family which is described as Helicase conserved C-terminal domain (PF00271)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
130  
265

PDB Hit:
pdb|1GM5|1GM5-A STRUCTURE OF RECG BOUND TO THREE-WAY DNA 426.0 0e+00
pdb|1HV8|1HV8-A CRYSTAL STRUCTURE OF A DEAD BOX PROTEIN FROM THE320.0 7e-88
pdb|1FUU|1FUU-A YEAST INITIATION FACTOR 4A 100.0 7e-22
pdb|1QDE|1QDE-A CRYS

Gene Protein Sequence:
MMSPETQKQLKITDVSAKKLDKLNLHTAWDLVLHLPLRYEDETHIMPIKD
APIGVPCQVEGEVIHQEVTFKPRKQLIVQIADGSGSVLFLRFIHFYASHQ
KQTAVGKRIRAVGEIKHGFYGDEMIHPKIRDAEGGGLAESLTPVYPTVNG
LNQPTLRRIIQTALDVTPLHDTLPDALLGRLKLPRLAESLRLLHSPPPSF
TIHQLSDGTLPAWQRLKFDELLAQQLSMRLARQKRVSGTAAALRGDGTLT
QALRQALPFALTDAQEKVVSEICRDMAQTHPMHRLLQGDVGSGKTIVAAL
SALTAIESGAQVAVMAPTEILAEQHFIKFKQWLEPLGIEVVCLFGSLRKK
AKDEAKAKLADGSVKIAVGTHALFSDGVAFHNLGLSIVDEQHRFGVAQRL
ALKNKGREVHQLMMSATPIPRTLAMSFFADLDVSVIDELPPGRTPIKTRL
VNNVRRAEVEGFVLGTCRKGRQAYWVCPLIEESETLQLQTAAETLARLQT
ALPEPNIGLVHGRMKAAEKAEVMAEFAAGRLNVLVATTVIEVGVDVPNAA
LMVIEHAERMGLAQLHQLRGRVGRGAGESVCVLLFAEPLGELAKARLKVI
YEHTDGFEIARQDLNIRGPGEFLGARQSGVPMLRFAKLEEDLHLLEQARE
TAPMLIEQNPEIVEAHLARWLSGREGYLGV

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGTCGCCCGAAACCCAGAAACAGCTCAAAATCACCGATGTTTCCGC
CAAGAAGCTCGACAAACTCAACCTCCATACCGCGTGGGATTTGGTGTTGC
ACCTGCCGCTGCGTTACGAGGACGAGACGCACATTATGCCGATTAAGGAC
GCGCCGATTGGCGTGCCGTGTCAGGTCGAGGGCGAGGTTATCCATCAGGA
AGTAACGTTCAAACCGCGCAAGCAGCTGATTGTCCAAATTGCCGACGGTT
CCGGCAGCGTCCTTTTTCTGCGCTTCATCCACTTTTACGCCAGCCATCAG
AAGCAGACGGCGGTCGGCAAACGCATCCGCGCCGTGGGCGAAATCAAACA
CGGATTTTACGGCGACGAGATGATTCATCCCAAAATCCGCGATGCCGAGG
GCGGCGGTTTGGCGGAAAGCCTCACGCCGGTTTACCCGACCGTAAACGGT
TTGAACCAGCCCACTTTGCGCCGCATCATTCAGACGGCGTTGGACGTTAC
GCCGCTGCACGACACCTTGCCTGATGCTTTATTAGGCCGTCTGAAGCTGC
CGCGCCTTGCCGAAAGCCTGCGCCTTTTGCATTCGCCGCCGCCGAGTTTC
ACTATTCATCAACTTTCAGACGGCACGCTGCCGGCGTGGCAGCGGCTCAA
ATTCGACGAACTTTTGGCGCAACAGTTGTCCATGCGTTTGGCGCGGCAGA
AGCGCGTCAGCGGCACGGCGGCGGCATTGCGCGGCGACGGCACATTGACC
CAAGCCCTGCGCCAAGCCCTGCCGTTTGCCCTGACCGATGCACAAGAAAA
AGTTGTTTCCGAAATCTGCCGCGATATGGCGCAAACCCACCCCATGCACC
GCCTGCTGCAAGGCGATGTCGGCAGCGGCAAAACCATCGTCGCCGCCTTA
TCCGCGCTGACCGCCATCGAATCAGGCGCGCAAGTGGCTGTAATGGCGCC
CACTGAAATCCTTGCCGAACAGCACTTCATCAAGTTCAAACAATGGCTCG
AACCTTTGGGCATTGAAGTTGTCTGCCTTTTTGGCAGTTTGCGCAAAAAA
GCCAAAGACGAAGCCAAAGCCAAACTCGCCGACGGCAGCGTCAAAATCGC
CGTCGGCACGCACGCCCTGTTTTCAGACGGCGTGGCGTTTCACAATTTGG
GCTTGAGCATTGTGGACGAACAGCACCGTTTCGGCGTTGCACAACGCCTC
GCACTCAAAAACAAAGGGCGCGAAGTCCATCAGCTGATGATGTCCGCCAC
ACCCATCCCGCGCACGCTCGCCATGAGTTTCTTCGCTGACTTGGACGTAT
CCGTCATCGACGAATTGCCGCCCGGGCGCACGCCGATTAAAACGCGCCTC
GTCAACAACGTCCGCCGCGCCGAAGTCGAAGGCTTCGTCCTCGGCACTTG
CCGAAAAGGGCGGCAGGCATATTGGGTCTGCCCATTGATTGAAGAAAGCG
AAACCCTGCAACTGCAAACCGCCGCCGAAACCCTCGCCCGGCTTCAGACG
GCATTGCCCGAACCCAATATCGGACTGGTACACGGGCGCATGAAGGCCGC
CGAAAAGGCCGAAGTCATGGCGGAATTTGCCGCAGGCCGTCTGAACGTCT
TGGTTGCCACCACCGTCATCGAAGTCGGCGTAGATGTGCCCAACGCCGCC
CTGATGGTGATCGAACACGCCGAGCGCATGGGCTTGGCGCAGCTTCACCA
ATTACGCGGACGGGTAGGGCGCGGCGCGGGGGAAAGCGTGTGCGTCCTCC
TGTTTGCCGAACCCTTGGGCGAACTCGCCAAAGCGCGGCTGAAAGTCATC
TACGAACACACCGACGGCTTCGAAATCGCCCGCCAAGACCTCAATATCCG
CGGCCCCGGCGAATTTCTCGGCGCGCGCCAAAGCGGCGTGCCTATGCTGC
GCTTCGCCAAGCTCGAAGAAGACTTACACCTTTTGGAACAAGCGCGCGAA
ACCGCCCCGATGCTGATTGAACAAAACCCTGAAATCGTCGAAGCGCATTT
GGCAAGGTGGCTTTCCGGCAGGGAAGGTTATTTGGGTGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy