Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0085 IGR0087 IGR0084 IGR0090.1 IGR0089 IGR0088 IGR0090 IGR0086 htrB, - NG0105 pbp3,dacB, - NG0107 NG0108 basR, - NG0111 gcp, - NG0104 resC, - NG0103 metK, - NG0106 basS, - NG0112 citN, - NG0110 htrB, - NG0105 pbp3,dacB, - NG0107 NG0108 basR, - NG0111 gcp, - NG0104 resC, - NG0103 metK, - NG0106 basS, - NG0112 citN, - NG0110 htrB, - NG0105 pbp3,dacB, - NG0107 basR, - NG0111 gcp, - NG0104 resC, - NG0103 metK, - NG0106 basS, - NG0112 citN, - NG0110 NG0109 NG0108 NG0109
* Calculated from Protein Sequence

Gene ID: NG0107

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pbp3  dacB  

Definition:
penicillin binding protein 3; D-alanyl-D-alanine carboxypeptidase

Gene Start:
121160

Gene Stop:
119754

Gene Length:
1407

Molecular Weight*:
50510

pI*:
9.90

Net Charge*:
8.32

EC:
3.4.16.4  3.4.99.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table

Secondary Evidence:
Tognoni,A., Franchi,E., Magistrelli,C., Colombo,E., Cosmina,P. and Grandi,G.
A putative new peptide synthase operon in Bacillus subtilis:
partial characterization
Microbiology 141 (Pt 3), 645-648 (1995)
Medline: 95227362

Granier,B., Duez,C., Lepage,S., Englebert,S., Dusart,J.,
Dideberg,O., Van Beeumen,J., Frere,J.M. and Ghuysen,J.M.
Primary and predicted secondary structures of the Actinomadura R39
extracellular DD-peptidase, a penicillin-binding protein (PBP)
related to the Escherichia coli PBP4
Biochem.J.282 (Pt 3), 781-788 (1992)
Medline: 92207168

Duez,C.,Joris,B.,Frere,J.M.,Ghuysen,J.M.and Van Beeumen,J.
The penicillin-binding site in the exocellular
DD-carboxypeptidase-transpeptidase of Actinomadura R39
Biochem. J. 193 (1), 83-86 (1981)
Medline: 82067969

Mottl,H.,Terpstra,P.and Keck,W.
Penicillin-binding protein 4 of Escherichia coli shows a novel type of primary structure among penicillin-interacting proteins
FEMS Microbiol.Lett. 78(2/3), 213-220 (1991)




Comment:
Oklahoma ID: NGO.107c

Blast Summary:  PSI-Blast Search
NG0107 is 99% identical to a previously sequenced Neisseria gonorrhoeae protein in GenBank, 3249049.

Residues 1-469 are 96% similar to a penicillin-binding protein 3 from Neisseria meningitidis group B strain MD58 (11353827|).

Significant hits in gapped BLAST to penicillin binding protein / D-alanyl-D-alanine carboxypeptidase sequences,e.g.residues 6-434 are 37% similar to a probable D-alanyl-D-alanine carboxypeptidase from Pseudomonas aeruginosa strain PAO1 (9949152|).Residues 34-417 are 28% similar to a penicillin-binding protein from Bacillus subtilis (2634218|).Residues 32-417 are 25% similar to penicillin-binding protein 4 and D-alanyl-D-alanine carboxypeptidase from Escherichia coli (1172030|).

COGS Summary:  COGS Search
BeTs to 4 clades of COG2027
COG name: D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4)
Functional Class:  M
The phylogenetic pattern of COG2027 is -------Cebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00922 (D-Ala-D-Ala carboxypeptidase 3 (S13) family signature) with a combined E-value of 1.7e-45.
    PR00922A    54-73
    PR00922B    279-301
    PR00922C    336-350
    PR00922D    351-365
    PR00922E    411-424


ProDom Summary:  Protein Domain Search
Residues 40-105 are identical to a (PROTEIN CARBOXYPEPTIDASE PRECURSOR DD-) protein domain (PD011380) which is seen in O85665_NEIGO.

Residues 274-416 are 32% similar to a (HYPOTHETICAL 46.4 KD PROTEIN) protein domain (PD114613) which is seen in P74173_SYNY3.

Residues 266-406 are 98% similar to a (PROTEIN CARBOXYPEPTIDASE PRECURSOR DD-) protein domain (PD006912) which is seen in O85665_NEIGO.

Residues 106-265 are 99% similar to a (PENICILLIN BINDING PROTEIN 3) protein domain (PD210564) which is seen in O85665_NEIGO.

Residues 407-469 are identical to a (PENICILLIN BINDING PROTEIN 3) protein domain (PD180110) which is seen in O85665_NEIGO.



Paralogs:  Local Blast Search


NG0107 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 56 to 433 (E-value = 2.9e-194) place NG0107 in the Peptidase_S13 family which is described as D-Ala-D-Ala carboxypeptidase 3 (S13) family (PF02113)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
21
cleavable N-terminal sequence  
1  
21
transmembrane  
423  
439

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNFPKTAASLLLLLASLAAHALDTGRIPQNEIAVYVQELDSGKVIIDHRA
GIPVNPASTMKLVTAFAAFKTFGSNYRWATEFKSNGTVNDGTLDGNLYWA
GSGDPVFNQENLLAVQRQLRDKGIRNITGRLMLDHSLWGEVGSPDHFEAD
SGSPFMTPPNPTMLSAGMVMVRAERNAAGSTDILTDPPLPHIFAQNNLKI
TASQAACPSVKKLMRASFSGNTLKLRGNIPESCLGKPVGVRMFALDELIR
QSFTNRWLLGGGRISDGIGIADTPEGAQTLAVAHSKPMKEILTDMNKRSD
NLIARSVFLKLGGDGKLPAVSEQAASAVRRELAVSGIDVADLVLENGSGL
SRKERVTARMMAQMLETAYFSPFAQDFIDTLPIAGTDGTLRNRFKQSGGL
LRLKTGTLNNVRALAGYWLGDKPMAVVVIINSGRAVSLLPDLDNFVAKNI
ISGGDGWLDAKLMCKERRA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTTCCCCAAAACAGCGGCCTCCCTGCTGCTGCTTCTCGCCTCCCT
CGCCGCACACGCGCTCGATACCGGCCGCATTCCGCAAAACGAAATCGCTG
TATATGTCCAAGAGCTTGACAGCGGAAAAGTCATCATTGACCACCGTGCC
GGCATACCCGTCAATCCCGCGTCCACGATGAAGCTCGTTACCGCGTTTGC
CGCCTTCAAAACCTTCGGCAGCAATTACCGCTGGGCGACCGAGTTTAAAA
GCAACGGTACGGTAAACGACGGCACGCTTGACGGAAACCTGTATTGGGCG
GGCAGCGGCGACCCCGTTTTCAATCAGGAAAACCTGCTTGCCGTCCAACG
CCAGTTGCGCGACAAAGGCATCCGCAATATCACGGGGCGCCTGATGCTCG
ACCACAGCCTGTGGGGCGAAGTCGGCAGTCCCGACCATTTTGAAGCCGAC
AGCGGTTCGCCGTTTATGACGCCCCCAAATCCGACTATGCTGTCTGCCGG
TATGGTTATGGTGCGCGCCGAACGCAATGCCGCCGGCAGTACCGACATCC
TCACCGATCCGCCTTTGCCGCATATTTTTGCCCAAAACAACTTGAAAATT
ACCGCCTCCCAAGCTGCCTGCCCTTCGGTCAAAAAACTGATGCGCGCATC
TTTTTCGGGCAATACGCTGAAATTGCGCGGCAATATTCCCGAAAGCTGTT
TGGGCAAGCCTGTCGGTGTCCGGATGTTCGCGCTTGACGAACTGATCCGC
CAAAGTTTTACCAACCGCTGGCTGCTCGGCGGCGGACGGATTTCAGACGG
CATCGGCATAGCCGACACACCGGAAGGCGCGCAGACGCTTGCCGTTGCAC
ACTCCAAACCGATGAAGGAAATTTTGACGGACATGAACAAGCGTTCGGAC
AATCTGATTGCGCGTTCCGTCTTCCTCAAACTCGGCGGCGACGGCAAACT
GCCCGCCGTTTCCGAACAGGCGGCGTCTGCCGTCCGGCGAGAACTTGCCG
TATCGGGCATCGATGTTGCGGATTTGGTTTTGGAAAACGGTTCGGGTCTG
TCCAGAAAAGAAAGGGTAACGGCGAGAATGATGGCGCAAATGTTGGAAAC
GGCTTATTTCAGCCCGTTTGCACAAGATTTCATCGACACGCTGCCCATCG
CCGGCACAGACGGGACTTTACGCAACCGCTTCAAACAAAGCGGCGGGCTG
TTGCGCTTAAAAACCGGCACGCTCAACAATGTCCGCGCCCTTGCAGGTTA
TTGGCTGGGCGACAAACCGATGGCGGTGGTCGTCATCATCAACAGCGGCC
GCGCCGTTTCCCTGCTGCCCGACTTGGACAACTTCGTTGCCAAAAACATC
ATCTCCGGCGGCGACGGCTGGCTGGATGCGAAACTGATGTGCAAAGAACG
CCGCGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy