Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0085 IGR0087 IGR0084 IGR0089 IGR0088 IGR0090 IGR0086 htrB, - NG0105 pbp3,dacB, - NG0107 NG0108 basR, - NG0111 gcp, - NG0104 metK, - NG0106 citN, - NG0110 resB, - NG0102 htrB, - NG0105 pbp3,dacB, - NG0107 NG0108 basR, - NG0111 gcp, - NG0104 metK, - NG0106 citN, - NG0110 resB, - NG0102 htrB, - NG0105 pbp3,dacB, - NG0107 basR, - NG0111 gcp, - NG0104 metK, - NG0106 citN, - NG0110 resB, - NG0102 NG0109 resC, - NG0103 resC, - NG0103 NG0108 NG0109
* Calculated from Protein Sequence

Gene ID: NG0106

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
metK  

Definition:
S-adenosyl methionine synthetase

Gene Start:
118490

Gene Stop:
119683

Gene Length:
1194

Molecular Weight*:
42982

pI*:
5.00

Net Charge*:
-9.91

EC:
2.5.1.6  

Functional Class:
Central intermediary metabolism; Other  
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Methionine metabolism
Selenoamino acid metabolism

Secondary Evidence:
Newman EB, Budman LI, Chan EC, Greene RC, Lin RT, Woldringh CL, D'Ari R.
Lack of S-adenosylmethionine results in a cell division defect in Escherichia coli.
J Bacteriol. 1998 Jul;180(14):3614-9.
PMID: 9658005

Wei Y, Newman EB.
Studies on the role of the metK gene product of Escherichia coli K-12.
Mol Microbiol. 2002 Mar;43(6):1651-6.
PMID: 11952912

Okamoto S, Lezhava A, Hosaka T, Okamoto-Hosoya Y, Ochi K.
Enhanced expression of S-adenosylmethionine synthetase causes overproduction of actinorhodin in Streptomyces coelicolor A3(2).
J Bacteriol. 2003 Jan;185(2):601-9.
PMID: 12511507

Comment:
See also NG2027, methionine biosynthesis transcriptional regulator (MetR). In addition, other 'met' genes include: NG2044, metG/metS; NG1149, metZ; NG0933, metX; NG0929, metF; NG0928, metE; NG0386, metC/metB2; all involved in methionine biosynthesis.

Oklahoma ID: NGO.106

Blast Summary:  PSI-Blast Search
Residues 10-398 have 97% similarity to AE002529,N. meningitidis (MC58) S-adenosylmethionine synthetase.
Residues 10-398 have 68% similarity to AP002563, E. coli methionine adenosyltransferase 1.


COGS Summary:  COGS Search
BeTs to 11 clades of COG0192
COG name: S-adenosylmethionine synthetase
Functional Class:  H
The phylogenetic pattern of COG0192 is ----Yqvcebrhujgpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002133 (S-adenosylmethionine synthetase) with a combined E-value of 6e-204.
    IPB002133A    13-57
    IPB002133B    85-117
    IPB002133C    124-154
    IPB002133D    175-226
    IPB002133E    252-288
    IPB002133F    289-326
    IPB002133G    327-376
    IPB002133A    25-69


ProDom Summary:  Protein Domain Search
Residues 14-384 are 69% similar to a (SYNTHETASE S-ADENOSYLMETHIONINE METHIONINE) protein domain (PD001322) which is seen in METK_ECOLI.



Paralogs:  Local Blast Search


NG0106 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 11 to 111 (E-value = 6.6e-53) place NG0106 in the S-AdoMet_synt_N family which is described as S-adenosylmethionine synthetase, N-terminal domain (PF00438)
Residues 124 to 244 (E-value = 7.8e-75) place NG0106 in the S-AdoMet_synt_M family which is described as S-adenosylmethionine synthetase, central domain (PF02772)
Residues 246 to 385 (E-value = 9.3e-86) place NG0106 in the S-AdoMet_synt_C family which is described as S-adenosylmethionine synthetase, C-terminal domain (PF02773)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1FUG|1FUG-A S-ADENOSYLMETHIONINE SYNTHETASE 530.0 0e+00
pdb|1QM4|1QM4-A METHIONINE ADENOSYLTRANSFERASE COMPLEXED WITH A 428.0 0e+00
pdb|1FUG|1FUG-A S-ADENOSYLMETHIONINE SYNTHETASE 678.0 0.000000
pdb|1QM4|1QM4-A ME

Gene Protein Sequence:
MVCFSRKISMSEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVA
AETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCA
VGVYYDQQSPDIAQGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAI
YYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLS
TQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQ
GDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIV
AAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLR
PKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTGTTTTTCAAGGAAAATTTCAATGAGCGAATATCTGTTTACTTC
CGAATCGGTTTCCGAAGGCCATCCGGACAAAGTAGCCGACCAAGTATCCG
ATGCGATTTTGGATGCCATCTTGGCGCAAGACCCCAAAGCGCGTGTCGCG
GCGGAAACTTTGGTCAACACAGGCTTGTGCGTATTGGCGGGCGAAATCAC
CACCACCGCCCAAGTGGACTACATCAAAGTCGCACGCGAAACCATCAAAC
GCATCGGCTACAACTCCTCCGAGCTGGGCTTTGACGCCAACGGCTGCGCG
GTCGGCGTGTACTACGACCAACAATCCCCCGACATCGCCCAAGGCGTGAA
CGAAGGCGAAGGCATCGACCTGAACCAAGGCGCGGGCGACCAAGGCTTGA
TGTTCGGCTATGCCTGCGACGAAACCCCGACCCTGATGCCGTTTGCCATC
TATTACAGCCACCGCCTGATGCAGCGTCAAAGCGAATTGCGCAAAGACGG
CCGCCTGCCTTGGCTGCGCCCTGACGCAAAAGCCCAACTGACCGTGGTTT
ACGACAGCGAAACCGGCAAGGTGAAACGCATTGATACCGTCGTCCTGTCC
ACCCAGCACGATCCTGCCATCAGCCAGGAAGAACTGAGTAAAGCCGTGAT
TGAGCAGATTATCAAGCCCGTTTTGCCGCCCGAACTGCTGACCGACGAAA
CAAAATACCTGATCAACCCGACCGGCCGCTTCGTCATCGGCGGCCCGCAA
GGCGACTGCGGTTTGACCGGCCGCAAAATCATTGTCGATACCTACGGCGG
CGCGGCTCCGCACGGCGGCGGCGCATTCTCCGGCAAAGACCCGTCCAAAG
TGGACCGTTCCGCCGCTTACGCCTGCCGTTATGTGGCGAAAAACATCGTC
GCCGCAGGCTTGGCAACCCAATGCCAAATCCAAGTTTCCTACGCCATCGG
CGTTGCCGAACCGACTTCGATTTCCATCGATACTTTCGGTACGGGTAAAA
TCAGCGAGGAAAAACTGATTGCGCTGGTTTGCGAACATTTCGACCTGCGT
CCCAAAGGCATCGTCCAAATGCTCGACCTCTTGCGCCCGATTTACGGAAA
ATCTGCCGCCTACGGGCATTTCGGCCGCGAAGAACCCGAGTTTACTTGGG
AACGCACCGACAAAGCGGCCTCATTGAAAGCGGCAGCGGGGCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy