Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0085 IGR0087 IGR0084 IGR0082 IGR0083 IGR0088 IGR0086 NG0100 htrB, - NG0105 pbp3,dacB, - NG0107 NG0108 cyc4, - NG0101 gcp, - NG0104 metK, - NG0106 resB, - NG0102 NG0100 htrB, - NG0105 pbp3,dacB, - NG0107 NG0108 cyc4, - NG0101 gcp, - NG0104 metK, - NG0106 resB, - NG0102 NG0100 htrB, - NG0105 pbp3,dacB, - NG0107 NG0108 cyc4, - NG0101 gcp, - NG0104 metK, - NG0106 resB, - NG0102 resC, - NG0103 resC, - NG0103
* Calculated from Protein Sequence

Gene ID: NG0104

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gcp  

Definition:
O-sialoglycoprotein endopeptidase

Gene Start:
116169

Gene Stop:
117230

Gene Length:
1062

Molecular Weight*:
37671

pI*:
6.40

Net Charge*:
-3.57

EC:
3.4.24.57  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.104

Blast Summary:  PSI-Blast Search
Residues 1-354 have 87% similarity to AL162753, N. meningitidis (Z2491) putative O-sialoglycoprotein endopeptidase.
Residues 1-352 have 49% similarity to U32735, H.influenzae(Rd) O-sialoglycoprotein endopeptidase (gcp).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0533
COG name: Metal-dependent proteases with possible chaperone activity
Functional Class:  O
The phylogenetic pattern of COG0533 is amtkYQvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000905 (Glycoprotease, (M22) metallo-protease family) with a combined E-value of 1.5e-92.
    IPB000905A    3-17
    IPB000905B    40-51
    IPB000905C    72-112
    IPB000905D    131-143
    IPB000905E    154-181
    IPB000905F    207-218
    IPB000905G    274-283
    IPB000905H    316-325


ProDom Summary:  Protein Domain Search
Residues 1-332 are 50% similar to a (ENDOPEPTIDASE O-SIALOGLYCOPROTEIN HYDROLASE) protein domain (PD002367) which is seen in GCP_HAEIN.



Paralogs:  Local Blast Search


NG0104 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 285 (E-value = 1e-120) place NG0104 in the Peptidase_M22 family which is described as Glycoprotease family (PF00814)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
40  
194

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MLVLGIESSCDETGVALYDTERGLRSHCLHTQMAMHAEYGGVVPELASRD
HIRRLVPLTEGCLAQAGASYGDIDAVAFTQGPGLGGALLAGSSYANALAL
ALDKPVIPVHHLEGHLLSPLLAEEKPDFPFVALLVSGGHTQIMAVRGIGD
YELLGESVDDAAGEAFDKTAKLLGLPYPGGAKLSELAESGRPEAFVFPRP
MIHSDDLQMSFSGLKTAVLTAVEKVREANGSETIPEQTRNNICRAFQDAV
VEVLEAKVKKALLQTGFRTVVVAGGVGANRKLRETFGNMTVQIPTPKGKP
KHPSEKVSVFFPPMAYCTDNGAMIAFAGAMHLGKGREVGAFNVRPRWSLS
EIVK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGGTATTAGGAATCGAATCTTCTTGCGACGAAACCGGCGTTGCGCT
GTACGACACCGAACGAGGATTGCGGTCGCACTGCCTGCACACTCAAATGG
CAATGCACGCGGAATACGGCGGGGTCGTGCCGGAATTGGCGAGCCGCGAC
CATATCCGCCGCCTTGTTCCGTTGACTGAAGGCTGTTTGGCGCAGGCAGG
CGCATCGTATGGCGATATTGACGCGGTTGCCTTTACGCAGGGGCCCGGTT
TGGGCGGTGCGCTGCTGGCGGGTTCGAGCTACGCCAACGCGCTGGCTTTA
GCGTTGGATAAGCCCGTCATCCCCGTCCATCATTTGGAAGGACATCTGCT
GTCGCCGCTGTTGGCGGAGGAAAAACCCGACTTTCCTTTTGTCGCGCTGT
TGGTTTCGGGCGGGCATACGCAGATTATGGCGGTCAGGGGCATAGGCGAT
TACGAGCTTTTGGGCGAGAGCGTCGATGATGCGGCGGGCGAGGCATTCGA
CAAAACGGCGAAACTGCTGGGTTTGCCGTATCCGGGCGGTGCGAAACTGT
CGGAACTTGCGGAATCGGGCAGGCCCGAAGCGTTTGTTTTTCCGCGCCCG
ATGATTCATTCCGACGATTTGCAGATGAGTTTTTCGGGATTGAAAACCGC
TGTTTTGACTGCCGTTGAAAAAGTGCGTGAGGCAAACGGTTCGGAAACCA
TACCCGAGCAAACCCGCAACAATATTTGCCGTGCGTTTCAAGATGCGGTA
GTAGAAGTGTTGGAGGCAAAAGTGAAAAAAGCCCTGTTGCAGACAGGGTT
CAGAACCGTAGTGGTCGCCGGCGGGGTCGGTGCAAACCGCAAACTCCGTG
AAACTTTCGGCAACATGACGGTACAAATCCCGACCCCCAAAGGCAAGCCG
AAACATCCGTCCGAAAAAGTCAGCGTGTTTTTCCCGCCGATGGCATACTG
CACGGACAACGGTGCCATGATTGCCTTTGCCGGTGCGATGCACCTGGGCA
AGGGCAGGGAGGTCGGTGCGTTCAACGTCCGTCCGCGTTGGTCGTTGTCC
GAAATCGTCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy