Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0078 IGR0077 IGR0076 IGR0072 IGR0071 IGR0074 IGR0070 IGR0073 IGR0075 NG0090 aroK, - NG0093 pilP, - NG0095 pilN, - NG0097 pilO, - NG0096 yafJ, - NG0091 aroB, - NG0092 ribD, - NG0089 NG0088 pilQ,omc, - NG0094 NG0090 aroK, - NG0093 pilP, - NG0095 pilN, - NG0097 pilO, - NG0096 yafJ, - NG0091 aroB, - NG0092 ribD, - NG0089 NG0088 pilQ,omc, - NG0094 NG0090 aroK, - NG0093 pilP, - NG0095 pilO, - NG0096 yafJ, - NG0091 aroB, - NG0092 ribD, - NG0089 NG0088 pilQ,omc, - NG0094 pilN, - NG0097
* Calculated from Protein Sequence

Gene ID: NG0093

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aroK  

Definition:
shikimate kinase

Gene Start:
102130

Gene Stop:
101621

Gene Length:
510

Molecular Weight*:
18964

pI*:
10.30

Net Charge*:
6.62

EC:
2.7.1.71  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Primary Evidence:
Barten,R. and Meyer,T.F.
Cloning and characterisation of the Neisseria gonorrhoeae aroB gene.
Mol. Gen. Genet. 258 (1-2), 34-44 (1998)
Medline: 98273626

Secondary Evidence:
Lyngstadaas A, Lobner-Olesen A, Boye E.
Characterization of three genes in the dam-containing operon of Escherichia coli.
Mol Gen Genet. 1995 Jun 10;247(5):546-54.
PMID: 7603433


Comment:
For other 'aro' genes,see NG0092 (aroB), NG0740 (aroD), NG0900
(aroA), NG1331 (aroC), NG1602 (aroE), and NG1695 (aroG).

Oklahoma ID: NGO.93c

Blast Summary:  PSI-Blast Search
NG0093 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 2661440, a predicted shikimate kinase.

Several matches in gapped BLAST to shikimate kinase sequences, e.g. residues 8-170 are 49% similar to the enzyme in P.aeruginosa (gb|AAG08424).

Residues 1-170 are virtually identical to NMA0648 in N.meningitidis (AL162753).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0703
COG name: Shikimate kinase
Functional Class:  E
The phylogenetic pattern of COG0703 is ----yqvcEBrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000623 (Shikimate kinase) with a combined E-value of 3.1e-39.
    IPB000623A    8-37
    IPB000623B    56-71
    IPB000623C    78-92
    IPB000623D    119-125
    IPB000623E    136-146


ProDom Summary:  Protein Domain Search
Residues 8-152 are 47% similar to a (SHIKIMATE KINASE AROMATIC AMINO ACID BIOSYNTHESIS) protein domain (PD004326) which is seen in AROK_HAEIN.


Paralogs:  Local Blast Search


NG0093 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 169 (E-value = 2.1e-54) place NG0093 in the SKI family which is described as Shikimate kinase (PF01202)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
52
transmembrane  
71  
87

PDB Hit:
pdb|1KAG|1KAG-A CRYSTAL STRUCTURE OF THE ESCHERICHIA COLI 128.0 7e-31
pdb|1SHK|1SHK-B THE THREE-DIMENSIONAL STRUCTURE OF SHIKIMATE 98.7 6e-22
pdb|1SHK|1SHK-A THE THREE-DIMENSIONAL STRUCTURE OF SHIKIMATE 97.5 1e-21
pdb|2SHK|2SHK-B THE

Gene Protein Sequence:
MKNFNGKLILIGLMGAGKTTLGRQMAQRLDYRFYDSDHEIAAAAGVPIPT
IFEMEGEQGFRSRETAILKKLIVLPHIVLSTGGGAVLKEENRALIRKSGT
VVYLHAPPETLLERTRCDNSRPLLQVADPLAKLRELYAARDPVYRQTADF
TVESANCRETVQTLLKRLSR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAACTTTAACGGCAAACTCATCCTCATCGGACTGATGGGCGCGGG
CAAAACTACGCTGGGCCGGCAAATGGCGCAGCGGCTGGATTACCGTTTTT
ACGACAGCGATCACGAAATCGCCGCAGCGGCGGGCGTTCCCATCCCCACC
ATATTTGAAATGGAAGGCGAACAGGGATTCCGTTCGCGCGAAACCGCCAT
ACTCAAAAAACTGATTGTCCTGCCGCATATCGTCCTGTCCACCGGCGGCG
GCGCGGTGTTAAAAGAAGAAAACCGCGCCCTTATCCGCAAAAGCGGCACG
GTCGTTTATCTGCACGCCCCGCCCGAAACCCTGCTCGAACGCACGCGCTG
CGACAACAGCCGCCCTTTGCTGCAAGTTGCCGATCCTTTGGCGAAATTGC
GCGAACTCTACGCCGCACGCGACCCCGTTTACCGCCAAACCGCCGACTTT
ACCGTAGAATCGGCAAACTGCCGGGAAACCGTGCAAACCCTGCTCAAACG
CTTATCCCGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy