Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0076 IGR0072 IGR0071 IGR0074 IGR0070 IGR0073 IGR0075 NG0090 aroK, - NG0093 pilP, - NG0095 yafJ, - NG0091 aroB, - NG0092 ribD, - NG0089 NG0088 pilQ,omc, - NG0094 NG0090 aroK, - NG0093 pilP, - NG0095 yafJ, - NG0091 aroB, - NG0092 ribD, - NG0089 NG0088 pilQ,omc, - NG0094 NG0090 aroK, - NG0093 pilP, - NG0095 yafJ, - NG0091 aroB, - NG0092 ribD, - NG0089 NG0088 pilQ,omc, - NG0094
* Calculated from Protein Sequence

Gene ID: NG0092

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aroB  

Definition:
3-dehydroquinate synthase

Gene Start:
101538

Gene Stop:
100462

Gene Length:
1077

Molecular Weight*:
38568

pI*:
6.60

Net Charge*:
-3.00

EC:
4.6.1.3  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Primary Evidence:
Barten,R. and Meyer,T.F.
Cloning and characterisation of the Neisseria gonorrhoeae aroB gene.
Mol. Gen. Genet. 258 (1-2), 34-44 (1998)
Medline: 98273626


Secondary Evidence:
Lyngstadaas A, Lobner-Olesen A, Boye E.
Characterization of three genes in the dam-containing operon of Escherichia coli.
Mol Gen Genet. 1995 Jun 10;247(5):546-54.
PMID: 7603433

Comment:
For other 'aro' genes,see NG0093 (aroK), NG0740 (aroD), NG0900 (aroA), NG1331 (aroC), NG1602 (aroE), and NG1695 (aroG).

Oklahoma ID: NGO.92c

Blast Summary:  PSI-Blast Search
NG0092 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 2661441, a predicted 3-dehydroquinate synthetase.

Several hits in gapped BLAST to 3-dehydroquinate synthetase sequences, e.g. residues 1-356 are 57% similar to the enzyme in P.aeruginosa ( gb|AAG08423).

Residues 1-359 are 91% similar to NMA0647 in N.meningitidis (AL162753).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0337
COG name: 3-dehydroquinate synthetase
Functional Class:  E
The phylogenetic pattern of COG0337 is ----y-vcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0092 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 356 (E-value = 1.5e-213) place NG0092 in the DHQ_synthase family which is described as 3-dehydroquinate synthase (PF01761)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
59
transmembrane  
99  
115
non-globular  
226  
316

PDB Hit:
pdb|1DQS|1DQS-A CRYSTAL STRUCTURE OF DEHYDROQUINATE SYNTHASE 180.0 4e-46
pdb|1KQ3|1KQ3-A CRYSTAL STRUCTURE OF GLYCEROL DEHYDROGENASE 48.1 2e-06
pdb|1DQS|1DQS-A CRYSTAL STRUCTURE OF DEHYDROQUINATE SYNTHASE 349.0 6e-97
pdb|1KQ3|1KQ3-A CRYS

Gene Protein Sequence:
MKTLTVHTPSHSYPIFIGNGLLPQAGSLLKPHLGKRAAIITNETVAPLYL
GTLQTALDAAGVSHFSIILPDGEAHKNWQTLNLIFDGLMQNRAERKTTLI
ALGGGVIGDMVGFAAATYQRGAPFIQIPTTLLSQVDSSVGGKTAINHPLG
KNMIGAFYQPQAVLADLDTLHTLPARELSAGMAEVIKYGALGDIGFFEWL
EQHMPELMALERAPLTQAVYRCCQMKADIVAQDETEQGIRAWLNLGHTFG
HAVEAEMGYGVWLHGEAVAAGCVLAARLSEQLGKTSAADTARLAALLEAA
GLPSAPPVFAFEKWLAHMSHDKKVSGGIMRFIGLNRLGEAVITEITDTDI
LRRTLQPYL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACACTGACCGTACACACGCCTTCGCACAGCTACCCCATCTTTAT
CGGCAACGGGCTGCTGCCGCAGGCGGGAAGCCTGCTCAAACCGCATTTGG
GCAAACGCGCCGCCATCATCACCAACGAAACCGTCGCCCCGCTCTACCTC
GGCACGCTTCAGACGGCATTGGATGCGGCAGGCGTATCCCATTTCAGCAT
CATCCTGCCCGACGGCGAGGCGCACAAAAACTGGCAGACGCTCAACCTCA
TCTTTGACGGGCTGATGCAAAACCGCGCCGAACGTAAAACCACGCTGATT
GCGCTGGGCGGCGGCGTGATCGGCGACATGGTCGGCTTTGCCGCCGCCAC
CTACCAGCGCGGCGCGCCGTTCATCCAAATACCGACCACGCTGTTGAGTC
AGGTCGACTCATCGGTGGGCGGAAAAACCGCCATCAACCACCCGCTCGGC
AAAAATATGATCGGCGCGTTTTACCAGCCGCAGGCGGTGCTTGCAGATTT
GGACACGCTGCACACCCTGCCCGCCCGCGAACTGTCCGCCGGTATGGCGG
AAGTCATCAAATACGGCGCGCTCGGCGACATCGGCTTTTTTGAATGGCTG
GAACAGCATATGCCCGAACTGATGGCACTCGAACGCGCGCCCCTCACCCA
AGCCGTGTACCGCTGCTGCCAAATGAAGGCAGACATCGTCGCCCAAGACG
AAACCGAACAGGGCATACGCGCATGGCTCAACCTCGGACACACCTTCGGA
CACGCCGTCGAAGCGGAAATGGGTTACGGCGTATGGCTGCACGGCGAGGC
CGTTGCCGCCGGCTGCGTGTTGGCGGCGCGTTTGTCCGAACAACTGGGCA
AAACCTCCGCCGCAGATACCGCGCGGCTCGCCGCCCTGCTCGAAGCCGCC
GGACTGCCGTCCGCACCGCCCGTGTTTGCCTTTGAAAAATGGCTGGCACA
TATGAGCCACGACAAAAAAGTCAGCGGCGGCATCATGCGCTTTATCGGTC
TGAACCGGCTGGGCGAAGCCGTCATCACCGAAATTACCGACACGGACATC
CTCCGGCGCACCCTGCAACCGTATCTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy