Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0067 IGR0065 IGR0066 IGR0068 IGR0064 IGR0063 pglC, - NG0084 pglB, - NG0085 avtA, - NG0082 pglD, - NG0083 dnaE, - NG0078 NG0079 NG0081 pglC, - NG0084 pglB, - NG0085 avtA, - NG0082 pglD, - NG0083 dnaE, - NG0078 NG0079 NG0081 pglC, - NG0084 pglB, - NG0085 avtA, - NG0082 pglD, - NG0083 dnaE, - NG0078 NG0081 NG0080 NG0079 NG0080
* Calculated from Protein Sequence

Gene ID: NG0082

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
avtA  

Definition:
valine--pyruvate aminotransferase

Gene Start:
88845

Gene Stop:
87556

Gene Length:
1290

Molecular Weight*:
46834

pI*:
5.50

Net Charge*:
-8.75

EC:
2.6.1.66  

Functional Class:
Amino acid biosynthesis; Branched chain amino acid family  
Amino acid biosynthesis; Pyruvate family  

Pathway: pathway table
Valine, leucine and isoleucine biosynthesis

Secondary Evidence:
Wang MD, Liu L, Wang BM, Berg CM.
Cloning and characterization of the Escherichia coli K-12 alanine-valine transaminase (avtA) gene.
J Bacteriol. 1987 Sep;169(9):4228-34.
PMID: 3040683

Comment:
Oklahoma ID: NGO.82c

For other aminotransferases, see NG2045 (glmS), NG0308 (bioA), NG0460, NG0646 (argD), NG1047 (aat), NG1241 (hisC), NG1283 (serC), NG1329 (tyrB), NG1452 (aspC).

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to valine-pyruvate aminotransferase sequences, e.g. residues 1-427 are 51% similar to the enzyme from V.cholerae (11356310).

Residues 1-430 are virtually identical to NMB1823 in N.meningitidis (11354229).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0436
COG name: PLP-dependent aminotransferases
Functional Class:  E
The phylogenetic pattern of COG0436 is AMTKYQVCEBRhUJ---linx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 345-427 are 43% similar to a (VALINE--PYRUVATE AMINOTRANSFERASE EC) protein domain (PD165773) which is seen in AVTA_ECOLI.

Residues 92-338 are 50% similar to a (PYRIDOXAL PHOSPHATE AMINOTRANSFERASE TRANSFERASE PROTEIN) protein domain (PD000087) which is seen in AVTA_ECOLI.

Residues 1-83 are 46% similar to a (VALINE--PYRUVATE AMINOTRANSFERASE EC) protein domain (PD131916) which is seen in AVTA_ECOLI.



Paralogs:  Local Blast Search


NG0082 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
258  
307

PDB Hit:
pdb|1BKG|1BKG-A ASPARTATE AMINOTRANSFERASE FROM THERMUS 56.6 8e-09
pdb|1BJW|1BJW-A ASPARTATE AMINOTRANSFERASE FROM THERMUS 56.6 8e-09
pdb|1GC3|1GC3-A THERMUS THERMOPHILUS ASPARTATE AMINOTRANSFERASE 55.4 2e-08
pdb|1GCK|1GCK-A THER

Gene Protein Sequence:
MQFSAFGEKFTQHSGILQLMDDLGDALKSDKPVNMLGGGNPARIPEIDRA
FADIFSKLAAEHAVENIGNYSNPQGDAALIDALTAFPNREYGWNLTVGNI
ALTNGSQNAFFYLFNLFGGKFKLSDGTSAEKAILLPLAPEYIGYADVHVE
GRHFVSVKPKIENVEHEGEAGFFKYRVDFDALENLPELKAGKIGAICCSR
PTNPTGNVLTDGEMARLDALAREHGIPPIIDNAYGMPFPNIIDSGVTLNW
HENIILCFSLSKVGLPGVRTGIIVAAPEAVKAVSSLNAIVNLAPTRFGAA
IAAPLLESGEMKRLADQVIRPFYRNQAQTAVSLLKRELGAYPMKIHKPEG
AIFLWLWFENLPVSSQTLYEMLKAEGTLIIPGEHFFVGIDTQDYPHAGEC
IRMSIAQDAQTLEKGIAAIGKTVRKPYDNV

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGTTCTCGGCATTCGGCGAAAAATTCACGCAACACAGCGGCATCCT
GCAACTGATGGACGACCTCGGCGACGCGCTCAAAAGCGACAAGCCCGTCA
ATATGCTCGGCGGCGGCAACCCGGCGCGCATTCCCGAAATCGATCGGGCG
TTCGCCGACATATTTTCCAAGCTGGCGGCGGAACACGCCGTCGAGAACAT
CGGCAACTACTCCAATCCCCAAGGCGATGCCGCGCTGATTGACGCGCTGA
CCGCCTTCCCCAACCGCGAATACGGCTGGAACCTGACCGTCGGCAATATC
GCGCTGACCAACGGTTCGCAAAACGCGTTTTTCTATTTATTCAACCTCTT
CGGCGGCAAATTCAAGCTTTCAGACGGCACATCCGCAGAAAAAGCCATTT
TGTTGCCGCTCGCGCCCGAATACATCGGCTATGCCGACGTGCATGTCGAA
GGGCGGCACTTCGTTTCCGTCAAACCCAAAATCGAAAACGTCGAACACGA
AGGCGAAGCAGGCTTCTTCAAATACCGCGTGGACTTTGACGCACTGGAAA
ACCTGCCCGAACTCAAAGCGGGCAAAATCGGCGCGATTTGCTGTTCGCGC
CCGACCAACCCGACCGGCAACGTGTTGACCGACGGCGAAATGGCGCGTTT
GGACGCTTTGGCGCGTGAACACGGCATTCCGCCGATTATCGACAACGCCT
ACGGAATGCCGTTCCCCAACATTATTGACAGCGGCGTAACGCTGAATTGG
CACGAAAACATCATCCTCTGCTTCAGCCTTTCCAAAGTCGGCCTGCCGGG
CGTTCGCACCGGCATCATCGTCGCCGCGCCCGAAGCCGTCAAAGCCGTCA
GCAGCCTAAACGCGATTGTGAACCTTGCCCCCACGCGCTTCGGCGCGGCC
ATCGCCGCCCCGCTGCTGGAAAGCGGCGAGATGAAACGGCTTGCCGACCA
AGTCATCCGGCCGTTTTACCGCAATCAGGCGCAAACCGCCGTTTCGCTGC
TCAAGCGCGAGCTGGGCGCGTACCCGATGAAAATCCACAAACCCGAAGGC
GCGATTTTCCTGTGGCTCTGGTTTGAAAACCTGCCCGTTTCGTCGCAAAC
CCTGTACGAAATGCTCAAAGCCGAAGGTACGCTGATTATTCCGGGCGAAC
ATTTCTTCGTCGGCATCGACACGCAAGACTACCCGCACGCGGGCGAGTGC
ATCCGTATGAGTATCGCACAGGACGCTCAAACGCTGGAAAAAGGCATCGC
CGCCATCGGCAAAACCGTCCGAAAACCGTACGACAACGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy