Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0057 IGR0060 IGR0061 IGR0058 IGR0059 IGR0058.1 IGR0062 IGR0055 IGR0056 NG0073 P.II,opaB, - NG0070 dnaE, - NG0078 NG0074 tonB, - NG0075 tpn, - NG0072.1 lspA, - NG0071 NG0077 lytB, - NG0072 NG0073 P.II,opaB, - NG0070 dnaE, - NG0078 NG0074 tonB, - NG0075 tpn, - NG0072.1 lspA, - NG0071 NG0077 lytB, - NG0072 Type: inverse, Name:  - 165 Type: tandem, Name:  - 8 Type: tandem, Name:  - 9 Type: direct, Name:  - 128 Type: inverse, Name:  - 180 NG0073 P.II,opaB, - NG0070 dnaE, - NG0078 tonB, - NG0075 tpn, - NG0072.1 lspA, - NG0071 lytB, - NG0072 NG0076 NG0077 NG0074 NG0076
* Calculated from Protein Sequence

Gene ID: NG0073

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
phosphatase/hydrolase (possible phosphoglycolate phosphatase)

Gene Start:
79472

Gene Stop:
78816

Gene Length:
657

Molecular Weight*:
23182

pI*:
5.30

Net Charge*:
-5.75

EC:
3.1.3.18  

Functional Class:
Unassigned  

Pathway: pathway table
Glyoxylate and dicarboxylate metabolism

Comment:
Oklahoma ID: NGO.73c

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to phosphoglycolate phosphatases and hydrolases e.g. residues 1-214 are 38% similar to a hydrolase from P.aeruginosa (11351395). Residues 3-214 are 31% similar to GPHC_ALCEU (730313).

Residues 1-219 are virtually identical to NMB1830 from N.meningitidis (11353843).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0546
COG name: Predicted phosphatases
Functional Class:  R
The phylogenetic pattern of COG0546 is a-TkyQ-CEBRhuj--oL---
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 7-115 are 32% similar to a (PHOSPHOGLYCOLATE PHOSPHATASE PGP) protein domain (PD003468) which is seen in GPHC_ALCEU.



Paralogs:  Local Blast Search


NG0073 is paralogously related to NG0203 (probable phosphoglycolate phosphatase) (7e-12) and NG1052 (phosphoglycolate phosphatase) (3e-11).


Pfam Summary:  Pfam Search
Residues 4 to 188 (E-value = 1.1e-25) place NG0073 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
136  
219

PDB Hit:
pdb|1FEZ|1FEZ-A THE CRYSTAL STRUCTURE OF BACILLUS CEREUS 39.9 4e-04
pdb|1LVH|1LVH-A THE STRUCTURE OF PHOSPHORYLATED 192.0 6e-50
pdb|1FEZ|1FEZ-A THE CRYSTAL STRUCTURE OF BACILLUS CEREUS 182.0 5e-47
pdb|1AQ6|1AQ6-A STRU

Gene Protein Sequence:
MTPPKLIIFDWDGTLADTTQPIIDTMRRSFAECGFPPPEAERVRSLIGYS
LPEIIRALLEMPSEAAVADIARTYSAHYLNPNNRNMTLFPDAPPCLDKLK
AQGFRLAVATGKGRAGLDNAISQTATGGYWLATACAGEYPSKPSPEMVFG
LCGELGLDPKEALVVGDTAHDLHMAANAGAAAVGVATGAHSREQLLGAPH
LAVLDGLSELPGFLARHYA

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCCCGCCCAAACTCATCATCTTCGACTGGGACGGCACGCTTGCCGA
TACGACCCAGCCCATCATCGACACCATGCGCCGCAGCTTCGCCGAATGCG
GTTTTCCGCCGCCCGAAGCGGAGCGCGTCCGCAGCCTGATCGGATACAGC
CTGCCCGAAATCATCCGCGCCCTGCTCGAAATGCCTTCTGAAGCTGCCGT
TGCCGACATCGCGCGCACTTATTCCGCGCATTACCTCAATCCCAACAACC
GCAATATGACACTCTTTCCCGATGCCCCGCCCTGTCTGGACAAGCTCAAA
GCGCAAGGCTTCCGGCTTGCCGTCGCCACGGGCAAAGGGCGGGCGGGTTT
GGACAACGCCATCAGCCAAACCGCCACCGGCGGCTATTGGCTCGCCACCG
CCTGCGCGGGGGAATACCCCTCCAAACCCTCGCCCGAAATGGTATTCGGA
CTCTGCGGCGAACTGGGACTCGACCCGAAAGAGGCATTGGTTGTCGGCGA
TACGGCGCACGACCTGCATATGGCGGCAAACGCAGGCGCGGCGGCAGTCG
GCGTTGCCACCGGCGCACATTCGCGCGAACAGCTCCTTGGCGCACCGCAT
CTCGCCGTATTGGACGGTTTGTCCGAACTGCCCGGTTTTCTTGCACGACA
TTACGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy