Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0057 IGR0060 IGR0061 IGR0058 IGR0059 IGR0058.1 IGR0062 IGR0055 IGR0056 NG0073 P.II,opaB, - NG0070 NG0074 tonB, - NG0075 tpn, - NG0072.1 lspA, - NG0071 NG0077 lytB, - NG0072 ileS, - NG0069 NG0073 P.II,opaB, - NG0070 NG0074 tonB, - NG0075 tpn, - NG0072.1 lspA, - NG0071 NG0077 lytB, - NG0072 ileS, - NG0069 Type: inverse, Name:  - 165 Type: tandem, Name:  - 8 Type: tandem, Name:  - 9 Type: direct, Name:  - 128 Type: inverse, Name:  - 180 NG0073 P.II,opaB, - NG0070 tonB, - NG0075 tpn, - NG0072.1 lspA, - NG0071 lytB, - NG0072 ileS, - NG0069 NG0076 NG0077 NG0074 NG0076
* Calculated from Protein Sequence

Gene ID: NG0071

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lspA  

Definition:
lipoprotein signal peptidase

Gene Start:
76565

Gene Stop:
77056

Gene Length:
492

Molecular Weight*:
18320

pI*:
9.80

Net Charge*:
3.66

EC:
3.4.23.36  

Functional Class:
Cellular processes; Protein and peptide secretion  

Pathway: pathway table
Protein export

Secondary Evidence:
Yamada H, Kitagawa M, Kawakami M, Mizushima S.
The gene coding for lipoprotein signal peptidase (lspA) and that for isoleucyl-tRNA synthetase (ileS) constitute a cotranscriptional unit in Escherichia coli.
FEBS Lett. 1984 Jun 11;171(2):245-8.
PMID: 6373377

Yu F, Yamada H, Daishima K, Mizushima S.
Nucleotide sequence of the lspA gene, the structural gene for lipoprotein signal peptidase of Escherichia coli.
FEBS Lett. 1984 Jul;173(1):264-8.
PMID: 6378662

Yamagata H, Taguchi N, Daishima K, Mizushima S.
Genetic characterization of a gene for prolipoprotein signal peptidase in Escherichia coli.
Mol Gen Genet. 1983;192(1-2):10-4.
PMID: 6227793

Comment:
Oklahoma ID: NGO.71

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to lipoprotein signal peptidase sequences, e.g. residues 1-163 are 46% similar to the enzyme from Pasteurella multocida (13431627). Residues 13-159 are 48% similar to the enzyme from P.aeruginosa (126492).

Residues 1-163 are 95% similar to the lipoprotein signal peptidase NMA0623 from N.meningitidis (11266046).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0597
COG name: Lipoprotein signal peptidase
Functional Class:  N
The phylogenetic pattern of COG0597 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001872 (Signal peptidase II/lipoprotein signal peptidase family (A8)) with a combined E-value of 7.1e-14.
    IPB001872    100-123


ProDom Summary:  Protein Domain Search
Residues 14-152 are 40% similar to a (SIGNAL PEPTIDASE II LIPOPROTEIN) protein domain (PD004304) which is seen in LSPA_HAEIN.



Paralogs:  Local Blast Search


NG0071 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 163 (E-value = 2e-57) place NG0071 in the Peptidase_A8 family which is described as Signal peptidase (SPase) II (PF01252)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
59
transmembrane  
72  
88
transmembrane  
136  
152

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSSSVSSKTRYWVLALAAIVLDQWSKWAVLSSFQYRERVNVIPSFFDLTL
VYNPGAAFSFLADQGGWQKYFFLVLAVAVSAYLVRAILRDEFAALGKIGA
AMIIGGASGNVIDRLIHGHVVDFLLFYWQNWFYPAFNIADSFICVGAVLA
VLDNIVHRKDSKKT

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTCATCTGTTTCAAGTAAAACGCGCTATTGGGTATTGGCACTTGC
CGCCATCGTGCTGGACCAGTGGTCGAAGTGGGCGGTGCTGTCGTCGTTTC
AGTATCGGGAACGCGTCAACGTCATCCCTTCGTTTTTCGATCTGACGCTG
GTGTACAATCCGGGCGCGGCATTCAGCTTCCTTGCCGATCAGGGCGGCTG
GCAGAAATACTTTTTTTTGGTGCTGGCGGTGGCGGTGAGCGCGTATTTGG
TACGCGCCATCTTGCGCGACGAGTTTGCAGCCCTCGGCAAAATCGGGGCG
GCAATGATTATCGGCGGTGCGTCGGGCAATGTCATCGATCGCCTGATACA
CGGTCATGTCGTCGATTTCTTATTGTTTTATTGGCAAAATTGGTTTTATC
CCGCCTTTAATATTGCCGACAGCTTTATCTGCGTCGGTGCGGTGTTGGCG
GTGCTTGACAATATCGTCCATCGCAAAGATAGCAAAAAAACG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy