Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0057 IGR0054 IGR0055 IGR0056 IGR0053 P.II,opaB, - NG0070 lspA, - NG0071 ribF, - NG0068 lytB, - NG0072 tyrS, - NG0066 ileS, - NG0069 P.II,opaB, - NG0070 lspA, - NG0071 ribF, - NG0068 lytB, - NG0072 tyrS, - NG0066 ileS, - NG0069 Type: direct, Name:  - 128 Type: tandem, Name:  - 7 Type: tandem, Name:  - 8 Type: tandem, Name:  - 9 Type: inverse, Name:  - 180 P.II,opaB, - NG0070 lspA, - NG0071 ribF, - NG0068 lytB, - NG0072 tyrS, - NG0066 ileS, - NG0069
* Calculated from Protein Sequence

Gene ID: NG0069

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ileS  

Definition:
isoleucyl-tRNA synthetase

Gene Start:
71315

Gene Stop:
74101

Gene Length:
2787

Molecular Weight*:
104221

pI*:
5.80

Net Charge*:
-18.52

EC:
6.1.1.5  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Valine, leucine and isoleucine biosynthesis

Comment:
Oklahoma ID: NGO.69

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to isoleucyl-tRNA ligase sequences. Residues 3-929 are 53% similar to SYI_HAEIN (pir||S78633).

Residues 1-929 are virtually identical to the ileS enzyme in N.meningitidis (AL162753).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0060
COG name: Isoleucyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0060 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001412 (Aminoacyl-transfer RNA synthetases class-I) with a combined E-value of 1.9e-10.
    IPB001412A    58-68
    IPB001412B    602-612


ProDom Summary:  Protein Domain Search
Residues 710-836 are 47% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD001183) which is seen in SYI_ECOLI.

Residues 134-207 are 75% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD002670) which is seen in SYI_HAEIN.

Residues 591-702 are 59% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD000476) which is seen in SYI_HAEIN.

Residues 398-482 are 65% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000647) which is seen in SYI_PSEFL.

Residues 394-485 are 36% similar to a (C25A1.7A PROTEIN) protein domain (PD118442) which is seen in O02222_CAEEL.

Residues 32-127 are 70% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000389) which is seen in SYI_HAEIN.

Residues 397-496 are 32% similar to a (ISOLEUCYL-TRNA SYNTHETASE, MUPIROCIN) protein domain (PD118443) which is seen in SYIP_STAAU.

Residues 306-397 are 48% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD000939) which is seen in SYI_HAEIN.

Residues 837-921 are 44% similar to a (SYNTHETASE AMINOACYL-TRNA ISOLEUCYL-TRNA) protein domain (PD009823) which is seen in SYI_ECOLI.

Residues 483-590 are 58% similar to a (SYNTHETASE ISOLEUCYL-TRNA AMINOACYL-TRNA) protein domain (PD002669) which is seen in SYI_PSEFL.



Paralogs:  Local Blast Search


NG0069 is paralogously related to NG1809 (valyl-tRNA synthetase) (2e-45), NG0006 (leucyl-tRNA synthetase) (3e-15) and NG2044 (methionyl-tRNA synthetase (MetG)) (4e-06).


Pfam Summary:  Pfam Search
Residues 27 to 644 (E-value = 4.3e-257) place NG0069 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)
Residues 889 to 918 (E-value = 1.2e-12) place NG0069 in the zf-FPG_IleRS family which is described as Zinc finger found in FPG and IleRS (PF06827)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
759  
775
non-globular  
774  
929

PDB Hit:
pdb|1FFY|1FFY-A INSIGHTS INTO EDITING FROM AN ILE-TRNA 722.0 0.000000
pdb|1JZQ|1JZQ-A 336.0 9e-93
pdb|1GAX|1GAX-A CRYSTAL STRUCTURE OF THERMUS THERMOPHILUS 219.0 2e-57
pdb|1H3N|1H3N-A LEUCYL-TRNA SYNTHETASE FROM THERMUS THERMOPHILUS

Gene Protein Sequence:
MTDYSKTVNLLESPFPMRGNLAKREPAWLKSWYEQKRYQKLREIAKGRPK
FILHDGPPYANGDIHIGHAVNKILKDIIIRSKTQAGFDAPYVPGWDCHGL
PIEVMVEKLHGKDMPKARFRELCREYAAEQIARQKKDFIRLGVLGDWDNP
YLTMDFKTEADTVRMLGEIYKSGYLYRGAKPVQFCLDCGSSLAEAEVEYK
DKVSPAIDVAYPFKNTVALAAAFGLAGIEGKAFAVIWTTTPWTLPASQAV
SAGADVVYQLIDTPKGKLVLAKDLAEGALKRYGFSDGIAILAETTGDKLE
NLHMNHPFLERDIPMLNGEHVTTDAGTGLVHTAPAHGLEDYAVCNKYGIE
LYNPVNAEGKYISETPRVAGMSVWEANPVILQWPEETGNLLASSKIEHSY
AHCWRHKTPLIYRATGQWFVGMDKAGSDGKTLRDKAIKAVDDTEFFPPWG
RARLESMIEGRPDWVVSRQRYWGTPMTFFVHKETGELHPNSAELLEKVAQ
RIEEKGIEAWFSLDKSELLSAEDCEHYDKLPDTMDVWFDSGSTHYSVVKQ
REELEWPADLYLEGSDQHRGWFQSSMLTGCASSMGRAPYKQLLTHGFVVD
QNGRKMSKSIGNVVAPQEVYNEFGADILRLWAASTDYSGELAISKEILKR
VTESYRRIRNTLSFLFANLSDFNPIEDAVQQADMVEIDRYALVLARRLQE
RLAGGYYPRYAFHFAVKDIVSFCSEDLGAFYLDILKDRLYTTKADSRARR
SAQTALYHITRSLVLLIAPILCFTGEEAWDIIGGGEEDSVLFHTWHEFPA
INEKAEAELVKKWTAIREAREAVTAAIEPLRADKTVGSSLQAEAEITAPE
EMAGYLNALGEELRFALLVSKAEVKVGDELAVAAKASDGEKCERCWHYTR
DVGAVAGYETVCKRCAENVGGEGETRHYA

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGATTACAGTAAAACCGTCAACCTGCTCGAAAGCCCGTTTCCGAT
GCGCGGCAATCTTGCCAAGCGCGAGCCTGCGTGGCTGAAAAGCTGGTACG
AGCAAAAACGTTACCAAAAACTGCGCGAAATCGCCAAAGGCCGTCCGAAA
TTCATTCTGCACGACGGCCCGCCGTATGCCAACGGCGACATCCATATCGG
TCATGCCGTCAATAAAATTCTTAAAGACATTATTATCCGCAGCAAAACCC
AAGCCGGTTTTGACGCGCCTTATGTACCGGGTTGGGACTGCCACGGCCTG
CCCATCGAAGTGATGGTGGAAAAACTGCACGGCAAAGATATGCCTAAAGC
CCGTTTCCGCGAATTGTGCCGCGAATATGCCGCCGAACAGATTGCCCGTC
AGAAAAAAGACTTTATCCGCTTGGGCGTGTTGGGCGACTGGGACAATCCT
TACTTGACCATGGATTTCAAAACCGAAGCCGATACCGTGCGTATGCTCGG
CGAAATCTACAAATCCGGCTATCTCTACCGGGGCGCGAAACCGGTTCAAT
TCTGCTTGGATTGCGGCTCTTCGCTGGCGGAAGCGGAAGTGGAATACAAA
GACAAAGTATCGCCTGCGATTGACGTTGCCTATCCGTTTAAAAACACCGT
CGCGCTTGCCGCCGCATTCGGCTTGGCAGGTATCGAAGGCAAAGCGTTTG
CCGTCATTTGGACGACCACGCCTTGGACTCTGCCTGCGAGCCAGGCCGTG
TCTGCCGGCGCGGACGTGGTGTATCAATTAATCGATACGCCCAAAGGCAA
ATTGGTGCTGGCGAAAGATTTGGCGGAAGGCGCTTTGAAACGCTACGGCT
TTTCAGACGGCATCGCCATCCTTGCCGAAACCACCGGCGACAAGCTGGAA
AACCTGCACATGAATCATCCGTTCCTCGAACGCGATATTCCCATGCTCAA
CGGCGAACACGTTACCACCGATGCCGGTACCGGCTTGGTGCATACTGCGC
CTGCGCACGGTTTGGAAGACTACGCCGTCTGCAATAAATACGGCATCGAG
CTTTACAACCCTGTCAACGCCGAAGGCAAATACATAAGCGAAACGCCTCG
TGTCGCAGGCATGAGCGTTTGGGAGGCGAATCCCGTCATCCTGCAATGGC
CGGAAGAAACCGGCAACCTCTTGGCAAGCAGCAAAATCGAACACAGCTAC
GCCCACTGCTGGCGCCACAAAACCCCGCTGATTTACCGAGCGACAGGTCA
GTGGTTTGTCGGCATGGACAAAGCCGGCAGCGACGGTAAAACCCTGCGCG
ACAAAGCCATCAAAGCCGTGGACGACACCGAATTCTTCCCGCCATGGGGT
CGTGCGCGTTTGGAATCCATGATTGAAGGCCGTCCTGACTGGGTGGTTTC
ACGCCAACGCTATTGGGGCACGCCGATGACTTTCTTTGTTCACAAAGAAA
CGGGCGAGCTGCATCCGAACTCTGCCGAACTTTTGGAAAAAGTCGCGCAA
CGCATCGAAGAAAAAGGCATCGAGGCTTGGTTCTCCCTCGATAAAAGCGA
ATTATTAAGCGCGGAAGATTGCGAACATTACGACAAACTCCCCGATACCA
TGGACGTATGGTTCGACTCAGGCTCGACGCATTATTCCGTTGTAAAACAA
CGCGAAGAATTGGAATGGCCGGCTGACTTGTACCTCGAAGGCAGCGACCA
ACACCGCGGCTGGTTCCAATCCTCTATGCTGACCGGTTGCGCCTCATCCA
TGGGACGCGCACCGTATAAACAGCTGCTGACCCACGGTTTCGTGGTTGAC
CAAAACGGCCGCAAAATGTCGAAATCCATCGGCAACGTCGTCGCGCCGCA
GGAAGTCTATAACGAATTCGGCGCGGACATCCTGCGCCTGTGGGCGGCAT
CCACCGATTACAGCGGCGAATTGGCGATTTCCAAAGAAATCCTCAAACGC
GTTACCGAAAGCTACCGCCGCATCCGCAATACCTTGAGCTTCCTGTTTGC
CAATTTGAGCGACTTTAATCCGATTGAAGATGCCGTGCAACAGGCGGATA
TGGTGGAAATCGACCGCTACGCCTTGGTATTGGCGCGGCGGCTGCAAGAG
CGTTTGGCAGGCGGTTACTATCCGCGCTATGCCTTCCACTTCGCCGTGAA
AGACATTGTTTCTTTCTGCTCGGAAGACTTGGGCGCGTTCTACCTCGACA
TCCTGAAAGACCGCCTCTACACCACCAAAGCCGACAGCCGCGCCCGCCGC
AGCGCGCAAACCGCCCTGTACCACATCACGCGCAGCCTGGTTCTCTTGAT
TGCACCGATTTTGTGCTTCACCGGCGAAGAAGCGTGGGACATCATCGGCG
GCGGCGAAGAAGACAGCGTCCTCTTCCATACTTGGCACGAGTTCCCGGCC
ATCAACGAAAAAGCCGAAGCCGAACTGGTGAAAAAATGGACGGCAATCCG
CGAAGCGCGCGAAGCAGTAACCGCCGCCATCGAGCCTTTGCGCGCCGACA
AAACCGTCGGTTCGTCCTTGCAGGCGGAAGCCGAAATTACCGCGCCGGAA
GAAATGGCCGGCTATCTGAATGCTTTGGGCGAAGAATTGCGCTTTGCCCT
GCTGGTGTCTAAAGCAGAAGTGAAAGTCGGTGATGAACTTGCCGTTGCCG
CCAAAGCCAGCGACGGCGAAAAATGCGAACGCTGCTGGCATTACACCCGC
GATGTGGGCGCGGTTGCAGGTTATGAAACCGTCTGCAAACGCTGTGCGGA
GAATGTCGGCGGAGAAGGCGAAACGCGCCATTACGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy