Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0052 IGR0054 IGR0055 IGR0056 IGR0053 P.II,opaB, - NG0070 ribF, - NG0068 tyrS, - NG0066 exoZ, - NG0065 ileS, - NG0069 P.II,opaB, - NG0070 ribF, - NG0068 tyrS, - NG0066 exoZ, - NG0065 ileS, - NG0069 Type: tandem, Name:  - 7 Type: tandem, Name:  - 8 Type: direct, Name:  - 128 Type: inverse, Name:  - 180 P.II,opaB, - NG0070 ribF, - NG0068 tyrS, - NG0066 exoZ, - NG0065 ileS, - NG0069
* Calculated from Protein Sequence

Gene ID: NG0068

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ribF  

Definition:
FAD synthase; riboflavin kinase; FMN adenylyltransferase

Gene Start:
70214

Gene Stop:
71170

Gene Length:
957

Molecular Weight*:
35673

pI*:
9.90

Net Charge*:
10.18

EC:
2.7.1.26  2.7.7.2  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Riboflavin  

Pathway: pathway table
Riboflavin metabolism

Secondary Evidence:
Richter,G., Fischer,M., Krieger,C., Eberhardt,S., Luttgen,H.,
Gerstenschlager,I. and Bacher,A.
Biosynthesis of riboflavin: characterization of the bifunctional
deaminase-reductase of Escherichia coli and Bacillus subtilis
J. Bacteriol. 179 (6), 2022-2028 (1997)
M:97221604


Comment:
Oklahoma ID: NGO.68

Foe other riboflavin synthesis proteins, see NG0089, NG0257, NG0704, NG0755.

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to FAD synthase/riboflavin kinase/FMN adenylyltransferase sequences e.g. residues 14-317 are 47% similar to the RibF in Pasteurella multocida (gb|AAK03745).

Residues 13-319 are virtually identical to a predicted riboflavin kinase/FMN adenylyltransferase in N.meningitidis (AL162753).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0196
COG name: FAD synthase
Functional Class:  H
The phylogenetic pattern of COG0196 is ----yqvceBrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002606 (Riboflavin kinase / FAD synthetase) with a combined E-value of 5.8e-75.
    IPB002606A    35-44
    IPB002606B    67-81
    IPB002606C    132-146
    IPB002606D    206-227
    IPB002606E    235-242
    IPB002606F    251-263
    IPB002606G    270-312


ProDom Summary:  Protein Domain Search
Residues 47-128 are 41% similar to a (RIBOFLAVIN KINASE FAD PROTEIN) protein domain (PD186238) which is seen in RIBF_HAEIN.

Residues 132-195 are 52% similar to a (RIBOFLAVIN PROTEIN KINASE FAD) protein domain (PD004889) which is seen in RIBF_ECOLI.

Residues 197-317 are 49% similar to a (PROTEIN RIBOFLAVIN KINASE BIOSYNTHESIS) protein domain (PD003662) which is seen in RIBF_HAEIN.



Paralogs:  Local Blast Search


NG0068 is paralogously related to NG0964 (Neisseria-specific protein) (0.001).


Pfam Summary:  Pfam Search
Residues 28 to 181 (E-value = 8.2e-68) place NG0068 in the Flavokinase family which is described as Riboflavin kinase (Flavokinase) (PF06574)
Residues 197 to 319 (E-value = 5e-38) place NG0068 in the FAD_Synth family which is described as Riboflavin kinase / FAD synthetase (PF01687)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
292  
319

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSEWRGFNRKGNTMKIRPGRHNAPDFPHGAAVTIGNFDGVHLGHKHILQK
LRLEADARGLPVVAVVFEPQPKEFFALRTGKTPPCRISPLRTKLELLEGT
GCVDAAWVLRFDRNFSEISAQAFIDRLLRQTLNTRYLLVGDDFRFGAGRE
GCFELLAQQPDMQTERTPSVIVEDIRTSSTAVRQALSDGNLAYAKKLLGH
DYVLGGRVVHGRKLGRTLNAPTANIRLPGHRYALGGVFVVEADGAFGTRR
GVASFGFNPTVDGGCSQKLEVHLFDFQGDLYGQRLNVRFLHKLRDEEKFD
GMEELKRRIEADMEAAKCW

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCGAGTGGCGGGGTTTCAACCGAAAAGGAAATACAATGAAAATCAG
GCCGGGGCGGCACAACGCGCCCGACTTTCCGCACGGGGCCGCCGTAACCA
TAGGCAATTTCGACGGCGTACACCTCGGACACAAACACATCCTCCAAAAA
CTCCGCCTCGAAGCCGACGCACGCGGATTGCCCGTCGTGGCCGTCGTTTT
CGAACCCCAACCCAAAGAATTTTTCGCACTCCGTACCGGCAAAACCCCGC
CCTGCCGTATCAGCCCCCTGCGTACCAAACTGGAATTGCTGGAAGGGACG
GGTTGCGTCGATGCCGCCTGGGTTTTGCGTTTCGATCGGAATTTTTCCGA
AATATCCGCGCAAGCATTTATCGACCGCCTGCTGCGTCAAACCTTGAATA
CGCGCTATTTGCTCGTCGGCGATGATTTCCGTTTCGGGGCGGGGCGGGAA
GGCTGTTTTGAACTTTTGGCACAACAGCCCGATATGCAGACCGAGCGCAC
GCCTTCTGTCATTGTCGAAGACATCCGCACCAGCAGTACCGCCGTCCGCC
AAGCCCTTTCAGACGGCAACCTTGCCTATGCGAAAAAACTTTTGGGGCAC
GACTACGTTTTGGGGGGCAGGGTGGTGCACGGCAGAAAACTCGGGCGCAC
CTTAAACGCCCCGACCGCCAACATCCGACTGCCCGGCCACCGTTATGCAC
TCGGCGGCGTGTTCGTCGTCGAGGCGGACGGCGCATTCGGCACGCGGCGC
GGCGTGGCGAGCTTCGGCTTCAATCCCACCGTTGATGGCGGCTGTTCTCA
AAAGCTGGAAGTCCATTTGTTCGACTTTCAAGGCGATTTGTACGGACAAC
GGTTGAACGTCCGCTTCCTGCACAAACTGCGCGACGAGGAAAAGTTTGAC
GGTATGGAAGAACTGAAAAGGCGGATTGAAGCCGATATGGAAGCCGCAAA
GTGTTGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy