Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0052 IGR0050 IGR0054 IGR0051 IGR0053 ribF, - NG0068 NG0063 tyrS, - NG0066 fthS, - NG0062 exoZ, - NG0065 ileS, - NG0069 ribF, - NG0068 NG0063 tyrS, - NG0066 fthS, - NG0062 exoZ, - NG0065 ileS, - NG0069 Type: tandem, Name:  - 7 ribF, - NG0068 NG0063 tyrS, - NG0066 fthS, - NG0062 exoZ, - NG0065 ileS, - NG0069
* Calculated from Protein Sequence

Gene ID: NG0066

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tyrS  

Definition:
tyrosyl-tRNA synthase

Gene Start:
66922

Gene Stop:
68214

Gene Length:
1293

Molecular Weight*:
47170

pI*:
6.30

Net Charge*:
-3.14

EC:
6.1.1.1  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Bedouelle H, Guez V, Vidal-Cros A, Hermann M.
Overproduction of tyrosyl-tRNA synthetase is toxic to Escherichia coli: a genetic analysis.
J Bacteriol. 1990 Jul;172(7):3940-5.
PMID: 2113914

Barker DG, Bruton CJ, Winter G.
The tyrosyl-tRNA synthetase from Escherichia coli. Complete nucleotide sequence of the structural gene.
FEBS Lett. 1982 Dec 27;150(2):419-23.
PMID: 6761148

Comment:
For other 'tyr' genes see NG1329 (tyrB) and NG1515 (tyrC).

Oklahoma ID: NGO.66

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to tyrosyl-tRNA synthetase sequences, e.g. residues 2-431 are 62% similar to the enzyme from E.coli (D90807).

Residues 1-431 are 94% similar to the tyr-tRNA ligase from N.meningitidis (gb|AAF42170).



COGS Summary:  COGS Search
BeTs to 16 clades of COG0162
COG name: Tyrosyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0162 is amtkYqvCeBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-325 are 71% similar to a (SYNTHETASE AMINOACYL-TRNA TYROSYL-TRNA) protein domain (PD005447) which is seen in SYY_ECOLI.

Residues 45-250 are 34% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD001451) which is seen in SYY_SYNY3.



Paralogs:  Local Blast Search


NG0066 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 26 to 325 (E-value = 4e-112) place NG0066 in the tRNA-synt_1b family which is described as tRNA synthetases class I (W and Y) (PF00579)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
274  
431

PDB Hit:
pdb|2TS1|2TS1 TYROSYL-TRANSFER /RNA$ SYNTHETASE (E.C.6.1.1.1) 442.0 0e+00
pdb|1JII|1JII-A CRYSTAL STRUCTURE OF S. AUREUS TYRRS IN COMPLEX 405.0 0e+00
pdb|1TYC|1TYC TYROSYL-TRANSFER RNA SYNTHETASE (E.C.6.1.1.1) 399.0 0e+00
pdb|1TYD|1TYD-E TYRO

Gene Protein Sequence:
MSVIQDLQSRGLIAQTTDIEALDALLNEQKIALYCGFDPTADSLHIGHLL
PVLALRRFQQAGHTPIALVGGATGMIGDPSFKAAERSLNSAETVAGWVGS
IRSQLTPFLSFEGGNAAIMANNADWFGSMNCLDFLRDIGKHFSVNAMLNK
ESVKQRIDRDGAGISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGN
ITAGIDLTRRLNQKQVFGLTLPLVTKSDGTKFGKTEGGAVWLNAKKTSPY
QFYQFWLKVADADVYKFLKYFTFLSIEEIGVVEAKDKASGSKPEAQRILA
EEMTRLIHGEEALAAAQRISESLFAEDQSRLTESDFEQLALDGLPAFEVS
DGINAVEALVKTGLAASNKEARGFVNAKAVLLNGKPAEANNPNHAAERPD
DAYLLIGEYKRFGKYTILRRGKRNHALLVWK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCGTCATCCAAGACCTGCAATCGCGCGGCCTTATCGCGCAAACCAC
CGACATCGAAGCCTTAGACGCTTTGCTGAACGAACAAAAAATCGCCCTTT
ACTGCGGTTTCGACCCGACAGCCGACAGCCTGCACATCGGACACCTGCTG
CCCGTATTGGCATTGCGCCGCTTCCAACAGGCGGGGCATACGCCGATTGC
ACTGGTGGGCGGCGCGACCGGTATGATCGGCGACCCCAGCTTCAAAGCCG
CCGAACGCAGCTTGAATTCCGCCGAAACCGTTGCCGGCTGGGTAGGAAGC
ATACGCAGCCAATTAACCCCTTTCTTGAGCTTTGAAGGCGGAAACGCCGC
CATTATGGCGAACAATGCCGACTGGTTCGGCAGCATGAACTGCCTCGACT
TCCTGCGCGACATCGGCAAGCATTTCTCCGTCAACGCCATGCTGAACAAA
GAATCCGTCAAACAGCGCATCGACCGCGACGGCGCAGGCATTTCCTTCAC
CGAGTTCGCCTATTCCCTGCTGCAAGGCTACGACTTCGCCGAGTTGAACA
AACGCCACGGCGCGGTTTTGGAAATCGGCGGTTCCGACCAGTGGGGCAAC
ATCACCGCCGGTATCGACCTGACCCGCCGCCTGAACCAAAAACAAGTGTT
CGGTCTGACCCTGCCTTTGGTTACCAAATCCGACGGTACCAAATTCGGCA
AAACCGAAGGCGGCGCGGTGTGGCTGAACGCGAAAAAAACCTCGCCGTAC
CAGTTCTACCAGTTCTGGCTGAAAGTCGCCGATGCCGATGTGTATAAATT
CCTGAAATACTTTACCTTCCTGTCCATCGAAGAAATCGGTGTCGTCGAAG
CCAAAGACAAGGCAAGCGGCAGCAAGCCCGAAGCGCAACGCATCCTCGCC
GAAGAAATGACCCGCCTGATTCACGGCGAAGAAGCCCTTGCCGCCGCGCA
ACGCATTTCCGAAAGCCTGTTTGCCGAAGACCAAAGCCGGCTTACCGAAA
GCGACTTCGAGCAGCTCGCCCTCGACGGCCTGCCTGCATTTGAAGTTTCA
GACGGCATCAACGCCGTCGAAGCCTTGGTCAAAACCGGCTTGGCAGCGTC
CAACAAAGAAGCGCGCGGCTTTGTCAATGCCAAAGCGGTTCTGCTCAACG
GCAAACCGGCTGAAGCCAACAACCCCAACCACGCCGCCGAACGCCCCGAC
GATGCCTATCTGTTGATAGGCGAATACAAACGTTTCGGCAAATACACCAT
CCTCCGGCGCGGCAAACGCAACCACGCGCTTTTGGTTTGGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy