Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Lys-1 IGR0048 IGR0049 IGR0052 IGR0050 IGR0047 IGR0049.1 IGR0051 IGR0045 IGR0046 NG0061 mrp, - NG0056 NG0058 hpaC, - NG0059 NG0057 NG0060 NG0063 tyrS, - NG0066 fthS, - NG0062 exoZ, - NG0065 NG0061 mrp, - NG0056 NG0058 hpaC, - NG0059 NG0057 NG0060 NG0063 tyrS, - NG0066 fthS, - NG0062 exoZ, - NG0065 NG0061 mrp, - NG0056 NG0058 hpaC, - NG0059 NG0057 NG0060 NG0063 tyrS, - NG0066 fthS, - NG0062 exoZ, - NG0065
* Calculated from Protein Sequence

Gene ID: NG0062

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fthS  

Definition:
formate--tetrahydrofolate ligase (FthS)

Gene Start:
61831

Gene Stop:
63504

Gene Length:
1674

Molecular Weight*:
59131

pI*:
6.60

Net Charge*:
-3.21

EC:
6.3.4.3  

Functional Class:
Central intermediary metabolism; Other  
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Folate biosynthesis
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate

Secondary Evidence:
Whitehead,T.R. and Rabinowitz,J.C.
Nucleotide sequence of the Clostridium acidiurici ('Clostridium
acidi-urici') gene for 10-formyltetrahydrofolate synthetase shows
extensive amino acid homology with the trifunctional enzyme
C1-tetrahydrofolate synthase from Saccharomyces cerevisiae.
J. Bacteriol. 170 (7), 3255-3261 (1988).
MEDLINE: 88257049

Crowley,P.J., Gutierrez,J.A., Hillman,J.D. and Bleiweis,A.S.
Genetic and physiologic analysis of a formyl-tetrahydrofolate
synthetase mutant of Streptococcus mutans
J. Bacteriol. 179 (5), 1563-1572 (1997)
MEDLINE: 97197518


Comment:
Oklahoma ID: NGO.62

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to formate--tetrahydrofolate ligase sequences, e.g. residues 4-557 are 57% similar to FTHS_CLOCY (gb|AAA23239).

Residues 1-558 are 91% similar to NMA0617 in N.meningitidis (AL162753).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB000559 (Formate-tetrahydrofolate ligase) with a combined E-value of 7.8e-267.
    IPB000559A    11-55
    IPB000559B    55-83
    IPB000559C    94-143
    IPB000559D    144-184
    IPB000559E    185-226
    IPB000559F    243-293
    IPB000559G    294-342
    IPB000559H    350-390
    IPB000559I    436-460
    IPB000559J    480-512
    IPB000559K    513-548
    IPB000559H    349-389


ProDom Summary:  Protein Domain Search
Residues 5-465 are 57% similar to a (SYNTHASE C-1-TETRAHYDROFOLATE C1-THF) protein domain (PD003089) which is seen in FTHS_MOOTH.

Residues 478-537 are 80% similar to a (SYNTHASE SYNTHETASE C-1-TETRAHYDROFOLATE) protein domain (PD186204) which is seen in FTHS_CLOCY.



Paralogs:  Local Blast Search


NG0062 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
194  
210
non-globular  
288  
392
transmembrane  
510  
526

PDB Hit:
pdb|1FP7|1FP7-A MONOVALENT CATION BINDING SITES IN N10- 610.0 0e+00
pdb|1EG7|1EG7-A THE CRYSTAL STRUCTURE OF FORMYLTETRAHYDROFOLATE 606.0 0e+00
pdb|1FP7|1FP7-A MONOVALENT CATION BINDING SITES IN N10- 612.0 0e+00
pdb|1EG7|1EG7-A THE

Gene Protein Sequence:
MSFKTDAETAQSSTMRPIGEIAAKLGLNVDNIEPYGHYKAKINPAEAFKL
PQKQGRLILVTAINPTPAGEGKTTVTIGLADALRHIGKDSVIALREPSLG
PVFGVKGGAAGGGYAQVLPMEDINLHFTGDFHAIGAANNLLAAMLDNHIY
QGNELNIDPKRVLWRRVVDMNDRQLRNIIDGMGKPVDGVMRPDGFDITVA
SEVMAVFCLAKDISDLKERFGNILVAYAKDGSPVYAKDLKAHGAMAALLK
DAIKPNLVQTIEGTPAFVHGGPFANIAHGCNSVTATRLAKHLADYAVTEA
GFGADLGAEKFCDIKCRLAGLKPDAAVVVATVRALKYNGGVERANLGEEN
LEALAKGLPNLLKHISNLKNVFGLPVVVALNRFVSDSDAELAMIEKACAE
HGVEVSLTEVWGKGGAGGADLARKVVNAIDNQPNNFGFAYDVELGIKDKI
RAIAQKVYGAEDVDFSAEASAEIASLEKLGLDKMPICMAKTQYSLSDNAK
LLGCPEGFRIAVRGITVSAGAGFIVALCGNMMKMPGLPKVPAAEKIDVDE
HGVIHGLF

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCTTCAAAACCGATGCCGAAACCGCCCAATCCTCCACCATGCGCCC
GATTGGCGAAATTGCCGCCAAGCTGGGTTTGAACGTTGACAACATTGAGC
CTTACGGTCATTACAAAGCCAAAATCAATCCTGCCGAAGCGTTCAAGCTG
CCGCAAAAACAAGGCAGGCTGATTTTGGTTACCGCCATCAACCCGACTCC
GGCGGGCGAAGGCAAAACCACCGTAACCATCGGTTTGGCGGACGCATTGC
GCCATATCGGCAAAGACTCTGTGATTGCTTTGCGCGAGCCTTCTTTGGGT
CCGGTGTTCGGCGTGAAAGGCGGCGCGGCAGGCGGCGGCTACGCGCAAGT
TTTGCCGATGGAAGACATCAACCTGCACTTCACCGGCGACTTCCACGCCA
TCGGTGCGGCGAATAACCTCCTCGCCGCCATGCTCGACAACCATATCTAC
CAAGGTAACGAGTTGAACATCGACCCCAAACGCGTGCTGTGGCGGCGCGT
GGTCGATATGAACGACCGCCAGTTGCGCAACATCATCGACGGTATGGGCA
AGCCTGTTGACGGCGTGATGCGTCCCGACGGCTTCGACATCACCGTCGCC
TCCGAAGTGATGGCGGTATTCTGCCTTGCCAAAGACATCAGCGATTTGAA
AGAGCGTTTTGGCAATATTCTCGTCGCCTACGCCAAAGACGGCAGCCCCG
TTTACGCCAAAGATTTGAAGGCACACGGCGCGATGGCGGCATTGCTAAAA
GATGCGATTAAGCCCAATTTGGTGCAAACCATCGAAGGCACTCCGGCCTT
TGTACACGGCGGCCCGTTCGCCAACATCGCCCACGGCTGCAACTCCGTTA
CCGCAACCCGTCTGGCGAAACACCTTGCCGATTACGCCGTAACCGAAGCA
GGCTTCGGCGCGGACTTGGGTGCGGAAAAATTCTGCGACATCAAATGCCG
CCTTGCCGGTTTGAAACCTGATGCGGCAGTCGTCGTGGCGACTGTCCGCG
CCCTGAAATACAACGGCGGCGTGGAACGCGCCAACCTTGGTGAAGAAAAC
CTCGAAGCCTTGGCAAAAGGTTTGCCCAACCTGTTGAAACACATTTCCAA
CCTGAAAAACGTATTCGGACTGCCCGTCGTCGTTGCGCTCAACCGCTTCG
TGTCCGACTCCGATGCCGAGTTGGCGATGATTGAAAAAGCCTGTGCCGAA
CACGGCGTTGAAGTTTCCCTGACCGAAGTGTGGGGCAAAGGCGGCGCGGG
CGGCGCGGATTTGGCGCGCAAAGTCGTCAATGCCATCGACAACCAACCTA
ATAACTTCGGTTTCGCCTACGATGTCGAGTTGGGCATCAAAGACAAAATC
CGTGCGATTGCCCAAAAAGTGTACGGCGCGGAAGATGTCGATTTCAGCGC
GGAAGCGTCTGCCGAAATCGCCTCGCTGGAAAAACTGGGCTTGGACAAAA
TGCCGATCTGCATGGCGAAAACCCAATATTCATTGAGCGACAACGCCAAA
CTCTTGGGCTGCCCCGAAGGCTTCCGCATCGCCGTACGCGGTATCACTGT
TTCCGCCGGCGCGGGCTTCATCGTTGCGTTGTGCGGCAATATGATGAAAA
TGCCGGGCCTGCCGAAAGTTCCGGCTGCCGAGAAAATCGATGTGGACGAA
CACGGCGTGATTCACGGCTTGTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy