Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Lys-1 IGR0048 IGR0049 IGR0050 IGR0047 IGR0049.1 IGR0051 IGR0045 IGR0046 IGR0044 NG0061 mrp, - NG0056 pilC, - NG0055 NG0058 hpaC, - NG0059 NG0057 NG0060 NG0063 fthS, - NG0062 exoZ, - NG0065 NG0061 mrp, - NG0056 pilC, - NG0055 NG0058 hpaC, - NG0059 NG0057 NG0060 NG0063 fthS, - NG0062 exoZ, - NG0065 Type: tandem, Name:  - 6 NG0061 mrp, - NG0056 pilC, - NG0055 NG0058 hpaC, - NG0059 NG0057 NG0060 NG0063 fthS, - NG0062 exoZ, - NG0065
* Calculated from Protein Sequence

Gene ID: NG0059

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hpaC  

Definition:
4-hydroxyphenylacetate 3-monooxygenase (NADH:FMN oxidoreductase)

Gene Start:
59981

Gene Stop:
60478

Gene Length:
498

Molecular Weight*:
18385

pI*:
7.00

Net Charge*:
0.00

EC:
1.14.13.3  

Functional Class:
Energy metabolism; Other  

Pathway: pathway table
Tyrosine metabolism

Secondary Evidence:
Prieto,M.A. and Garcia,J.L.
Molecular characterization of 4-hydroxyphenylacetate 3-hydroxylase
of Escherichia coli. A two-protein component enzyme.
J. Biol. Chem. 269 (36), 22823-22829 (1994).
MEDLINE: 94357932

Galan B, Diaz E, Prieto MA, Garcia JL.
Functional analysis of the small component of the
4-hydroxyphenylacetate 3-monooxygenase of Escherichia coli W: a prototype of a new Flavin:NAD(P)H reductase
subfamily.
J Bacteriol. 2000 Feb;182(3):627-36.
PMID: 10633095


Comment:
Oklahoma ID: NGO.59

In E.coli, this enzyme consists of large (HpaB) and small (HpaC) components in a single operon. A sequence similar to the E.coli HpaB sequence was not found in N.gonorrhoeae or N.meningitidis.

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to 4-hydroxyphenylacetate 3-monooxygenase small chain sequences, e.g. residues 9-165 are 49% similar to the chain in P.aeruginosa (gb|AAG07479).

Residues 1-166 are virtually identical to NMA0614 in N.meningitidis (AL162753).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1853
COG name: Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family
Functional Class:  R
The phylogenetic pattern of COG1853 is A-Tk-qVCEBR---------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002563 (Flavin reductase-like domain) with a combined E-value of 6e-19.
    IPB002563A    43-76
    IPB002563B    118-135


ProDom Summary:  Protein Domain Search
Residues 12-163 are 48% similar to a (PROTEIN MONOOXYGENASE OXIDOREDUCTASE) protein domain (PD002643) which is seen in O68232_PHOLU.



Paralogs:  Local Blast Search


NG0059 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 166 (E-value = 6.1e-44) place NG0059 in the Flavin_Reduct family which is described as Flavin reductase like domain (PF01613)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1I0R|1I0R-A CRYSTAL STRUCTURE OF FERRIC REDUCTASE FROM 42.6 5e-05

Gene Protein Sequence:
MADLQKTFQTSFRDAMASCAAGVHVITTDGAAGRYGITMTAVAPVTDEPP
TVMLCINRSARIIPILSENGSLCINMLADEHQDVAEHFAGLTGLSPEERF
AYHIWHRGKTGQLEIEGALAHLHGHIVGKHEIGTHFVFYVRLDEIKNCGC
KRPALLYFRRQFRPLD

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGGATTTGCAGAAAACTTTTCAAACTTCGTTCCGTGATGCGATGGC
ATCCTGTGCGGCAGGCGTTCATGTCATCACGACAGACGGTGCGGCAGGGC
GTTACGGCATTACAATGACGGCGGTTGCGCCGGTTACCGACGAGCCGCCG
ACCGTGATGCTGTGCATAAACCGGAGTGCGCGAATCATTCCGATCCTGTC
GGAAAACGGCAGCCTCTGCATCAATATGCTGGCGGACGAACATCAGGATG
TTGCCGAACATTTTGCCGGGCTGACCGGCCTGTCGCCCGAAGAGCGGTTT
GCCTACCATATTTGGCATCGCGGCAAAACGGGACAACTTGAAATAGAAGG
CGCGTTGGCGCACCTGCACGGGCATATTGTCGGCAAACATGAAATCGGCA
CGCATTTTGTGTTTTACGTCAGGCTCGACGAAATCAAAAACTGCGGGTGC
AAACGCCCCGCGCTGCTGTATTTCAGACGGCAGTTTAGGCCTTTAGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy