Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0039 IGR0040.1 IGR0041.1 IGR0041 IGR0042 IGR0043 IGR0040 IGR0040.2 IGR0044 NG0049.2 NG0049.1 NG0052 NG0050 NG0049 carA, - NG0053 pilC, - NG0055 carB, - NG0048 NG0054 NG0049.2 NG0049.1 NG0052 NG0050 NG0049 carA, - NG0053 pilC, - NG0055 carB, - NG0048 NG0054 Type: tandem, Name:  - 5 Type: direct, Name:  - 115 NG0049.1 NG0050 NG0049 carA, - NG0053 pilC, - NG0055 carB, - NG0048 NG0049.2 NG0052 NG0054
* Calculated from Protein Sequence

Gene ID: NG0053

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
carA  

Definition:
carbamoylphosphate synthase small subunit (CarA)

Gene Start:
51657

Gene Stop:
50527

Gene Length:
1131

Molecular Weight*:
40610

pI*:
5.20

Net Charge*:
-12.38

EC:
6.3.5.5  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Glutamate metabolism
Pyrimidine metabolism

Primary Evidence:
Lawson,F.S., Billowes,F.M. and Dillon,J.A.
Organization of carbamoyl-phosphate synthase genes in Neisseria
gonorrhoeae includes a large, variable intergenic sequence which is also present in other Neisseria species.
Microbiology 141 (Pt 5), 1183-1191 (1995).
Medline: 95291461


Secondary Evidence:
Kwon,D.H., Lu,C.D., Walthall,D.A., Brown,T.M., Houghton,J.E. and
Abdelal,A.T.
Structure and regulation of the carAB operon in Pseudomonas aeruginosa and Pseudomonas stutzeri: no untranslated region exists
J. Bacteriol. 176 (9), 2532-2542 (1994)
Medline: 94222830

Thoden,J.B., Holden,H.M., Wesenberg,G., Raushel,F.M. and Rayment,I.
Structure of carbamoyl phosphate synthetase: a journey of 96 A from substrate to product
Biochemistry 36 (21), 6305-6316 (1997)
Medline: 97317071

Piette,J., Nyunoya,H., Lusty,C.J., Cunin,R., Weyens,G., Crabeel,M.,Charlier,D., Glansdorff,N. and Pierard,A.
DNA sequence of the carA gene and the control region of carAB:
tandem promoters, respectively controlled by arginine and the
pyrimidines, regulate the synthesis of carbamoyl-phosphate
synthetase in Escherichia coli K-12
Proc. Natl. Acad. Sci. U.S.A. 81 (13), 4134-4138 (1984)
Medline: 84248072

Bouvier,J.,Patte,J.C.and Stragier,P.
Multiple regulatory signals in the control region of the
Escherichia coli carAB operon
Proc. Natl. Acad. Sci. U.S.A. 81 (13), 4139-4143 (1984)
Medline: 84248073

Nyunoya,H. and Lusty,C.J.
The carB gene of Escherichia coli: a duplicated gene coding for the large subunit of carbamoyl-phosphate synthetase
Proc. Natl. Acad. Sci. U.S.A. 80 (15), 4629-4633 (1983)
Medline: 83273669

Thoden,J.B., Holden,H.M., Wesenberg,G., Raushel,F.M. and Rayment,I.
Structure of carbamoyl phosphate synthetase: a journey of 96 A from substrate to product
Biochemistry 36 (21), 6305-6316 (1997)
Medline: 97317071

Thoden,J.B., Raushel,F.M., Benning,M.M., Rayment,I. and Holden,H.M.
The structure of carbamoyl phosphate synthetase determined to 2.1-A resolution
Acta Crystallogr. D 55, 8-24 (1999)

Thoden,J.B., Raushel,F.M., Wesenberg,G. and Holden,H.M.
The binding of inosine monophosphate to Escherichia coli carbamoyl
phosphate synthetase
J. Biol. Chem. 274 (32), 22502-22507 (1999)
Medline: 99357782






Comment:
Oklahoma ID: NGO.53c

For the large subunit chain (CarB), see NG0048.

Blast Summary:  PSI-Blast Search
NG0053 corresponds to the previously sequenced predicted CarA product in N.gonorrhoeae, 1000500.

Numerous hits in gapped BLAST to carbamoylphosphate synthase small subunit sequences. Residues 1-374 are 69% similar to the CarA in Pasteurella multocida (gb|AAK03586).

Residues 1-377 are 94% similar to NMB1849 in N.meningitidis (gb|AAF42183).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0505
COG name: Carbamoylphosphate synthase small subunit
Functional Class:  E,F
The phylogenetic pattern of COG0505 is amt-YqvceBr-uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002474 (Carbamoyl-phosphate synthase small chain) with a combined E-value of 1.9e-141.
    IPB002474A    7-13
    IPB002474B    28-56
    IPB002474C    90-132
    IPB002474D    190-216
    IPB002474E    231-242
    IPB002474F    275-314
    IPB002474G    326-367
***** IPB000991 (Glutamine amidotransferase class-I) with a combined E-value of 2.4e-11.
    IPB000991A    261-270
    IPB000991B    344-354


ProDom Summary:  Protein Domain Search
Residues 5-134 are 99% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE LIGASE SMALL) protein domain (PD001375) which is seen in Q50983_NEIGO.

Residues 156-231 are 84% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE LIGASE SMALL) protein domain (PD105693) which is seen in Q50983_NEIGO.

Residues 232-368 are 98% similar to a (SYNTHASE GLUTAMINE BIOSYNTHESIS AMIDOTRANSFERASE) protein domain (PD000306) which is seen in Q59598_NEIGO.



Paralogs:  Local Blast Search


NG0053 is paralogously related to NG1204 (anthranilate synthase component II) (5e-11) and NG2164 (GMP synthetase) (3e-04).


Pfam Summary:  Pfam Search
Residues 4 to 151 (E-value = 9.6e-88) place NG0053 in the CPSase_sm_chain family which is described as Carbamoyl-phosphate synthase small chain, CPSase domain (PF00988)
Residues 192 to 370 (E-value = 1.7e-70) place NG0053 in the GATase family which is described as Glutamine amidotransferase class-I (PF00117)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
262  
278

PDB Hit:
pdb|1BXR|1BXR-B STRUCTURE OF CARBAMOYL PHOSPHATE SYNTHETASE 487.0 0e+00
pdb|1M6V|1M6V-B CRYSTAL STRUCTURE OF THE G359F (SMALL SUBUNIT) 483.0 0e+00
pdb|1C30|1C30-B CRYSTAL STRUCTURE OF CARBAMOYL PHOSPHATE 483.0 0e+00
pdb|1CS0|1CS0-B CRYS

Gene Protein Sequence:
MNTPALLVLADGSVFHGTSIGYEGSASGEVVFNTSMTGYQEILTDPSYCK
QIVTLTYPHIGNTGTNAEDEESRSVYAAGLIIRDLPLLHSSFRASESLHD
YLVRNETVAIADIDTRRLTMLLREKGAQGGAILTGADATVEKAQELIAAF
GSMVGKDLAKEVSCTETYEWTEGEWELGKGFVTPDKQPYHVVAYDFGVKT
NILRMLASRGCRLTVVPAQTSAEDVLALNPDGVFLSNGPGDPEPCTYAIE
AVQKLMESGKPIFGICLGHQLISLAIGAKTLKMRFSHHGANHPVQDLDSG
KVVITSQNHGFAVDADTLPANARITHKSLFDNTLQGIELTDKPVFCFQGH
PEASPGPQDVGYLFDKFIGNMKAAKQA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACACCCCCGCCCTCCTCGTCCTCGCTGACGGCAGCGTATTCCACGG
CACATCAATCGGTTACGAAGGTTCGGCTTCCGGCGAAGTCGTGTTCAATA
CTTCGATGACCGGCTATCAGGAAATCCTGACCGACCCGTCCTACTGCAAA
CAAATCGTTACCCTCACCTACCCCCACATCGGCAATACCGGCACCAACGC
CGAAGATGAAGAAAGCCGCAGCGTTTACGCCGCAGGCCTGATTATCCGCG
ACCTGCCGCTCTTGCACAGCAGCTTCCGCGCCTCCGAAAGCCTGCACGAC
TATTTGGTACGCAACGAAACCGTCGCCATCGCCGACATCGACACCCGCCG
CCTGACCATGCTGTTGCGCGAAAAAGGCGCGCAAGGCGGCGCGATTCTGA
CAGGTGCGGATGCCACCGTTGAAAAAGCGCAAGAACTCATCGCCGCGTTC
GGCAGCATGGTCGGCAAAGATTTGGCAAAAGAAGTTTCCTGCACGGAAAC
TTACGAATGGACGGAAGGCGAATGGGAATTGGGCAAAGGTTTCGTTACCC
CTGACAAACAGCCTTACCACGTCGTCGCCTACGATTTCGGCGTGAAAACC
AACATCCTGCGTATGCTCGCCTCGCGCGGCTGCCGCCTGACCGTCGTCCC
CGCACAAACGAGCGCGGAAGACGTGTTGGCACTCAATCCCGACGGCGTGT
TCCTGTCCAACGGCCCCGGCGACCCCGAGCCTTGCACCTACGCCATCGAA
GCCGTGCAAAAACTGATGGAAAGCGGCAAACCGATTTTCGGCATCTGCTT
GGGACACCAGCTCATCAGCCTCGCCATCGGCGCGAAAACCCTGAAAATGC
GCTTCAGCCACCACGGTGCGAACCATCCTGTGCAAGATTTGGACAGCGGC
AAAGTCGTCATTACCAGCCAAAACCACGGTTTCGCCGTCGATGCCGACAC
CCTGCCCGCCAACGCACGCATTACCCACAAATCCTTGTTCGACAATACCT
TGCAAGGCATCGAGCTGACCGACAAACCCGTGTTCTGTTTCCAAGGACAC
CCCGAAGCCAGCCCGGGTCCGCAAGATGTCGGCTATTTGTTCGACAAATT
CATTGGCAATATGAAGGCTGCAAAACAAGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy