Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0039 IGR0040.1 IGR0041.1 IGR0037 IGR0036 IGR0038 IGR0041 IGR0040 IGR0040.2 NG0049.2 NG0049.1 NG0052 NG0050 accB, - NG0045 NG0049 carA, - NG0053 accC, - NG0044 carB, - NG0048 queA, - NG0047 NG0049.2 NG0049.1 NG0052 NG0050 accB, - NG0045 NG0049 carA, - NG0053 accC, - NG0044 carB, - NG0048 queA, - NG0047 Type: tandem, Name:  - 5 NG0049.1 NG0050 accB, - NG0045 NG0049 carA, - NG0053 accC, - NG0044 carB, - NG0048 NG0046 NG0046 NG0049.2 NG0052 queA, - NG0047
* Calculated from Protein Sequence

Gene ID: NG0048

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
carB  

Definition:
carbamoyl phosphate synthase large subunit (CarB)

Gene Start:
47430

Gene Stop:
44218

Gene Length:
3213

Molecular Weight*:
117485

pI*:
4.90

Net Charge*:
-33.89

EC:
6.3.5.5  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Glutamate metabolism
Pyrimidine metabolism

Primary Evidence:
Lawson,F.S., Billowes,F.M. and Dillon,J.A.
Organization of carbamoyl-phosphate synthase genes in Neisseria
gonorrhoeae includes a large, variable intergenic sequence which is also present in other Neisseria species.
Microbiology 141 (Pt 5), 1183-1191 (1995).
Medline: 95291461

Haas,R. and Meyer,T.F.
The repertoire of silent pilus genes in Neisseria gonorrhoeae:
evidence for gene conversion. Cell 44 (1), 107-115 (1986)
Medline: 86079567

Correia,F.F., Inouye,S. and Inouye,M.
A family of small repeated elements with some transposon-like
properties in the genome of Neisseria gonorrhoeae. J. Biol. Chem. 263 (25), 12194-12198 (1988)
Medline: 88315001



Secondary Evidence:
Holden HM, Thoden JB, Raushel FM.
Carbamoyl phosphate synthetase: an amazing biochemical odyssey from substrate to product.
Cell Mol Life Sci. 1999 Oct 30;56(5-6):507-22. Review.
PMID: 11212301

Comment:
Oklahoma ID: NGO.48c

For the small subunit, see NG0053.

Blast Summary:  PSI-Blast Search
NG0048 corresponds to the previously sequenced AAA74996 in GenBANK, a predicted carbamoyl phosphate synthetase (glutamine) large subunit.

Numerous hits in gapped BLAST to carbamoyl phosphate synthase large chain sequences. Residues 1-1068 are 67% similar to the enzyme chain in V.cholerae (gb|AAF95532).

Residues 1-1071 are virtually identical to the chain in NMB (7227111|gb|AAF4218).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0458
COG name: Carbamoylphosphate synthase large subunit (split gene in MJ)
Functional Class:  E,F
The phylogenetic pattern of COG0458 is aMT-YQvceBr-uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000901 (Carbamoyl-phosphate synthase) with a combined E-value of 2.7e-12.
    IPB000901    699-722
    IPB000901    159-182


ProDom Summary:  Protein Domain Search
Residues 863-937 are 97% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE LIGASE LARGE) protein domain (PD000705) which is seen in Q59599_NEIGO.

Residues 938-969 are 90% similar to a (CARBAMOYL PHOSPHATE SYNTHETASE GLUTAMINE) protein domain (PD111280) which is seen in Q59599_NEIGO.

Residues 479-550 are 69% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE LIGASE LARGE) protein domain (PD001652) which is seen in Q51430_PSEAE.

Residues 418-472 are 92% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE LIGASE LARGE) protein domain (PD001706) which is seen in Q59599_NEIGO.

Residues 940-997 are 46% similar to a (CARBAMOYL-PHOSPHATE LARGE BIOSYNTHESIS PROTEIN) protein domain (PD002195) which is seen in O67233_AQUAE.

Residues 622-861 are 91% similar to a (LIGASE SYNTHETASE CARBOXYLASE CARBAMOYL-PHOSPHATE) protein domain (PD000180) which is seen in Q59599_NEIGO.

Residues 551-602 are 86% similar to a (CARBAMOYL-PHOSPHATE SYNTHASE SYNTHETASE LIGASE LARGE) protein domain (PD000704) which is seen in CARB_ECOLI.



Paralogs:  Local Blast Search


NG0048 is paralogously related to NG0044 (acetyl-CoA carboxylase/biotin carboxylase chain) (7e-10) and NG1531 (D-alanine--D-alanine ligase (DdlB)) (5e-08).


Pfam Summary:  Pfam Search
Residues 6 to 126 (E-value = 3.5e-58) place NG0048 in the CPSase_L_chain family which is described as Carbamoyl-phosphate synthase L chain, N-terminal domain (PF00289)
Residues 128 to 364 (E-value = 5.4e-124) place NG0048 in the CPSase_L_D2 family which is described as Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786)
Residues 419 to 542 (E-value = 4.4e-71) place NG0048 in the CPSase_L_D3 family which is described as Carbamoyl-phosphate synthetase large chain, oligomerisation domain (PF02787)
Residues 552 to 666 (E-value = 1.7e-22) place NG0048 in the CPSase_L_chain family which is described as Carbamoyl-phosphate synthase L chain, N-terminal domain (PF00289)
Residues 668 to 891 (E-value = 5.1e-28) place NG0048 in the CPSase_L_D2 family which is described as Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786)
Residues 939 to 1037 (E-value = 4.7e-25) place NG0048 in the MGS family which is described as MGS-like domain (PF02142)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
33
transmembrane  
10  
26
transmembrane  
810  
826

PDB Hit:
pdb|1BXR|1BXR-A STRUCTURE OF CARBAMOYL PHOSPHATE SYNTHETASE 1472.0 0.000000
pdb|1CE8|1CE8-A CARBAMOYL PHOSPHATE SYNTHETASE FROM ESCHERICHIS 1470.0 0.000000
pdb|1A9X|1A9X-A CARBAMOYL PHOSPHATE SYNTHETASE: CAUGHT IN THE ACT1428.0 0.000000
pdb|1BNC|1B

Gene Protein Sequence:
MPKRTDLKSILIIGAGPIVIGQACEFDYSGAQACKALREEGYKVILVNSN
PATIMTDPEMADVTYIEPIMWQTVEKIIAKERPDAILPTMGGQTALNCAL
DLARNGVLAKYNVELIGATEDAIDKAEDRGRFKEAMEKIGLSCPKSFVCH
TMNEALAAQEQVGFPTLIRPSFTMGGSGGGIAYNKDEFLAICERGFDASP
THELLIEQSVLGWKEYEMEVVRDKADNCIIICSIENFDPMGVHTGDSITV
APAQTLTDKEYQIMRNASLAVLREIGVDTGGSNVQFAVNPENGEMIVIEM
NPRVSRSSALASKATGFPIAKVAAKLAVGFTLDELRNDITGGRTPASFEP
SIDYVVTKIPRFAFEKFPAADDRLTTQMKSVGEVMAMGRTIQESFQKALR
GLETGLCGFNPRSEDKAEIRRELANPGPERMLFVADAFRAGFTPEEIHEI
CAIDPWFLAQIEDLMKEEKSVSDGQLQDLDYAALRRLKRKGFSDKRLAQL
LNVSEKEVREHRYALKLHPVYKRVDTCAAEFATETAYLYSTYEEECESRP
SDRKKVMILGGGPNRIGQGIEFDYCCVHAALALRESGFETIMVNCNPETV
STDFDTSDRLYFEPLTLEDVLEIVRTENPWGVIVHYGGQTPLKLANALVE
NGVNIIGTSADSIDAAEDRERFQKVLNDLGLRQPPNRIAHNEEEALVKAE
EIGYPLVVRPSYVLGGRAMQIIHSAEQLQKYMREAVQVSEDSPVLLDFFL
NNAIEVDVDCVSDGKDVVIGGIMQHVEQAGIHSGDSGCSLPPYSLSEEIQ
DEIRRQTKAMAYALGVVGLMNVQFAVQDGVVFVLEVNPRASRTVPFVSKA
TGVPLAKVGARCMAGISLKEQGVEKEVVPDFYAVKEAVFPFIKFPGVDTI
LGPEMRSTGEVMGVGASFGEAYYKAQLGAGERLNPTGKIFLSVREEDKER
VIKTAKNFQALGYGICATRGTAQYLTEHGLIVQAINKVPEGRPHIGDALK
NGEIALVVNTVSSDPQSVSDSHIIRQSALQQRVPQYTTTAGGEAMSEGAK
SRDYLGVYSVQELHGRLKNRN

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCAAACGTACCGACCTAAAATCCATCCTTATCATCGGCGCCGGCCC
TATCGTTATCGGTCAGGCCTGCGAATTTGACTATTCGGGCGCACAGGCCT
GCAAGGCTTTGCGTGAAGAAGGCTATAAAGTCATTCTGGTGAATTCCAAC
CCCGCCACGATCATGACCGACCCCGAAATGGCGGATGTTACCTACATCGA
GCCGATTATGTGGCAGACGGTGGAGAAGATTATCGCCAAGGAGCGGCCCG
ATGCGATTCTGCCCACGATGGGCGGTCAGACCGCGCTGAACTGTGCGCTG
GATTTGGCGCGTAACGGCGTGCTGGCGAAATATAATGTCGAGTTAATCGG
CGCAACGGAAGACGCGATCGACAAGGCGGAAGACCGCGGCCGCTTTAAAG
AAGCGATGGAAAAAATCGGCCTCTCTTGCCCGAAATCTTTTGTCTGCCAC
ACCATGAACGAAGCCTTGGCGGCGCAAGAACAGGTCGGCTTTCCGACGCT
GATTCGTCCGTCTTTCACGATGGGCGGTTCGGGCGGCGGCATTGCCTACA
ATAAGGATGAGTTTTTGGCGATTTGCGAACGCGGTTTCGATGCGTCGCCT
ACGCATGAGCTGCTGATTGAGCAGTCTGTGCTCGGCTGGAAAGAGTACGA
GATGGAAGTGGTGCGCGATAAGGCGGACAACTGCATCATCATCTGTTCGA
TTGAAAACTTCGACCCGATGGGCGTTCATACGGGCGACTCGATTACGGTT
GCGCCGGCGCAAACGCTGACGGACAAGGAATACCAAATCATGCGCAACGC
TTCGTTGGCGGTATTGCGCGAAATCGGCGTGGACACGGGCGGCTCGAACG
TGCAGTTTGCGGTGAACCCTGAAAACGGCGAGATGATTGTGATCGAGATG
AACCCGCGTGTGAGCCGTTCGTCCGCGCTGGCTTCCAAAGCAACGGGCTT
CCCGATTGCGAAGGTGGCGGCGAAGCTGGCGGTCGGCTTTACGCTGGACG
AGTTGCGCAACGACATCACCGGCGGCCGCACGCCCGCGTCGTTCGAGCCT
TCCATCGACTATGTGGTAACCAAAATCCCGCGTTTCGCGTTTGAAAAATT
CCCCGCCGCAGACGACCGCCTGACCACGCAGATGAAATCTGTGGGTGAAG
TAATGGCGATGGGCCGTACCATTCAGGAAAGCTTCCAAAAAGCCCTGCGC
GGTTTGGAAACCGGCTTGTGCGGTTTCAATCCGCGCAGCGAAGACAAAGC
GGAAATCCGCCGCGAACTGGCCAACCCCGGCCCCGAACGTATGCTGTTTG
TGGCAGACGCGTTCCGCGCGGGCTTCACGCCGGAAGAAATCCACGAGATC
TGCGCCATCGACCCTTGGTTCTTGGCGCAAATCGAAGACTTGATGAAGGA
AGAAAAATCGGTTTCAGACGGCCAGTTGCAAGATTTGGATTACGCCGCCC
TACGCCGTCTGAAACGCAAAGGCTTCTCCGACAAACGTTTGGCACAATTG
TTGAACGTAAGCGAAAAAGAAGTTCGCGAACACCGCTACGCGCTGAAGCT
GCATCCGGTTTACAAACGCGTCGATACCTGCGCCGCCGAGTTCGCCACCG
AAACCGCCTATCTTTACTCCACTTACGAAGAAGAATGCGAATCCCGTCCT
TCCGACCGTAAAAAAGTGATGATTCTCGGCGGCGGCCCGAACCGCATCGG
TCAGGGCATCGAGTTTGACTACTGCTGCGTTCACGCCGCACTCGCCCTGC
GCGAATCGGGCTTTGAAACGATTATGGTCAACTGCAACCCCGAAACCGTG
TCCACCGACTTCGACACCAGCGACCGCCTCTATTTCGAGCCGCTGACATT
GGAAGACGTGTTGGAAATCGTCCGCACCGAAAACCCGTGGGGCGTGATTG
TTCATTACGGCGGTCAAACCCCGCTGAAACTCGCCAACGCATTGGTTGAA
AACGGCGTGAACATCATCGGCACATCCGCCGACAGCATCGATGCCGCCGA
AGACCGCGAACGCTTCCAAAAAGTGTTGAACGACTTAGGCCTGCGCCAAC
CGCCCAACCGCATCGCCCACAACGAAGAAGAAGCACTCGTCAAAGCCGAA
GAAATCGGTTATCCGCTGGTCGTGCGCCCGTCTTATGTTTTGGGCGGCCG
CGCCATGCAGATTATCCACTCCGCCGAGCAGTTGCAAAAATATATGCGCG
AAGCCGTGCAGGTTTCCGAAGACAGCCCCGTGCTGCTCGATTTCTTCCTC
AACAACGCGATTGAAGTCGATGTGGACTGCGTTTCAGACGGCAAAGATGT
GGTTATCGGCGGCATCATGCAGCACGTCGAACAGGCGGGCATCCACTCCG
GCGACTCCGGCTGCTCGCTGCCGCCCTACTCCTTAAGCGAAGAAATCCAA
GACGAAATCCGCCGCCAAACCAAAGCGATGGCGTACGCGCTGGGCGTGGT
CGGACTGATGAACGTGCAGTTTGCCGTGCAGGACGGCGTGGTGTTCGTGT
TGGAAGTGAACCCGCGCGCCAGCCGTACCGTCCCCTTTGTCTCCAAAGCC
ACCGGCGTGCCGCTCGCCAAAGTCGGCGCGCGCTGCATGGCAGGCATTTC
CCTGAAAGAACAAGGCGTGGAAAAAGAAGTCGTCCCCGATTTCTATGCCG
TTAAAGAAGCCGTGTTCCCATTCATCAAATTCCCGGGCGTGGATACGATT
TTGGGTCCGGAAATGCGCTCCACCGGCGAAGTGATGGGCGTGGGCGCAAG
TTTCGGCGAAGCCTACTACAAAGCCCAACTCGGCGCGGGCGAACGCCTCA
ACCCGACCGGCAAAATCTTCCTCTCCGTGCGCGAAGAAGACAAAGAACGC
GTCATTAAAACCGCCAAAAACTTCCAAGCCTTAGGCTACGGCATCTGCGC
CACGCGCGGCACGGCGCAATACCTGACCGAACACGGGCTGATTGTGCAGG
CCATCAACAAAGTCCCCGAAGGCCGCCCGCACATCGGCGACGCGCTGAAA
AACGGCGAAATCGCACTGGTCGTAAATACCGTTTCCAGCGATCCGCAATC
CGTGTCCGACAGCCACATCATCCGCCAAAGCGCATTGCAGCAACGCGTGC
CGCAATACACCACCACCGCCGGCGGCGAAGCGATGAGCGAAGGCGCGAAA
AGCCGGGATTATCTGGGTGTGTACAGCGTTCAAGAGCTGCACGGTCGTTT
GAAAAACCGCAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy