Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0039 IGR0034 IGR0035 IGR0037 IGR0036 IGR0038 IGR0040 IGR0033 NG0049.1 accB, - NG0045 NG0049 NG0042 prmA, - NG0043 accC, - NG0044 carB, - NG0048 queA, - NG0047 NG0049.1 accB, - NG0045 NG0049 NG0042 prmA, - NG0043 accC, - NG0044 carB, - NG0048 queA, - NG0047 Type: tandem, Name:  - 5 Type: direct, Name:  - 119 Type: direct, Name:  - 120 Type: inverse, Name:  - 184 accB, - NG0045 NG0049 NG0042 prmA, - NG0043 accC, - NG0044 carB, - NG0048 NG0046 NG0046 NG0049.1 queA, - NG0047
* Calculated from Protein Sequence

Gene ID: NG0047

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
queA  

Definition:
S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthase)

Gene Start:
42974

Gene Stop:
44011

Gene Length:
1038

Molecular Weight*:
38139

pI*:
6.40

Net Charge*:
-4.13

EC:
5.4.99.-  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Secondary Evidence:
Grimm C, Klebe G, Ficner R, Reuter K.
Screening orthologs as an important variable in crystallization: preliminary X-ray diffraction studies of the tRNA-modifying enzyme S-adenosyl-methionine:tRNA ribosyl transferase/isomerase.
Acta Crystallogr D Biol Crystallogr. 2000 Apr;56 ( Pt 4):484-8.
PMID: 10739928

Van Lanen SG, Daoud Kinzie S, Matthieu S, Link T, Culp J, Iwata-Reuyl D.
tRNA modification by S-adenosylmethionine: tRNA ribosyltransferase-isomerase (QueA): Assay Development and Characterization of the Recombinant Enzyme.
J Biol Chem. 2003 Jan.
PMID: 12533518

Dineshkumar TK, Thanedar S, Subbulakshmi C, Varshney U.
An unexpected absence of queuosine modification in the tRNAs of an Escherichia coli B strain.
Microbiology. 2002 Dec;148(Pt 12):3779-87.
PMID: 12480882

Kinzie SD, Thern B, Iwata-Reuyl D.
Mechanistic studies of the tRNA-modifying enzyme QueA: a chemical imperative for the use of AdoMet as a "ribosyl" donor.
Org Lett. 2000 May;2(9):1307-10.
PMID: 10810734

Mueller SO, Slany RK.
Structural analysis of the interaction of the tRNA modifying enzymes Tgt and QueA with a substrate tRNA.
FEBS Lett. 1995 Mar;361(2-3):259-64.
PMID: 7698334

Comment:
Oklahoma ID: NGO.47

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to S-adenosylmethionine:tRNA-ribosyltransferase-isomerase sequences, e.g. residues 1-341 are 59% similar to the enzyme from Pseudomonas syringae (gb|AAF71483).

Residues 1-343 are virtually identical to the NMB1859 in N.meningitidis (gb|AAF42193).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0809
COG name: S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase)
Functional Class:  J
The phylogenetic pattern of COG0809 is -----qvceb-huj--o---x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003699 (Queuosine biosynthesis protein) with a combined E-value of 2.2e-134.
    IPB003699A    1-31
    IPB003699B    42-71
    IPB003699C    136-152
    IPB003699D    158-195
    IPB003699E    244-259
    IPB003699F    288-338


ProDom Summary:  Protein Domain Search
Residues 1-214 are 54% similar to a (RIBOSYLTRANSFERASE-ISOMERASE S-ADENOSYLMETHIONINE:TRNA) protein domain (PD009740) which is seen in QUEA_ECOLI.

Residues 215-338 are 59% similar to a (RIBOSYLTRANSFERASE-ISOMERASE S-ADENOSYLMETHIONINE:TRNA) protein domain (PD011331) which is seen in QUEA_ECOLI.



Paralogs:  Local Blast Search


NG0047 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 214 (E-value = 9.1e-97) place NG0047 in the Queuosine_synth family which is described as Queuosine biosynthesis protein (PF02547)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MDISDFDFTLPEHLIAQHPPEVRGSSRLLVALSDMPLQDRVFGDLPDYVE
AGDVLVFNNTKVMKARLFGQKDSGGRIEALIERVLDNHTALAHIRSSKSP
KPGMGLVFEGGIRAVMVGREGELFCLRFEGGQTVYELLEQNGHLPLPPYI
ERAADADDDSRYQTVYAKYQGAVAAPTAGLHFTEELLRRLKDKGAVTAEV
TLHVGAGTFQPVRVDKIEEHKMHSEWFEVPSETVAAVEAAKARGNKAWAV
GTTSMRALESAARATGYLKDGQGDTDIFITPGYRFNVVDRLVTNFHLPKS
TLLMLVGAFSGMGHIRAVYRHAIEREYRFFSYGDAMVLGRNEGGGL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATATTTCAGATTTTGACTTTACCCTGCCCGAACACCTGATTGCCCA
GCATCCGCCCGAGGTGCGCGGCAGCAGCCGGCTTTTGGTCGCGCTGTCCG
ATATGCCGCTGCAAGACCGGGTGTTTGGCGATTTGCCCGATTATGTCGAG
GCAGGCGACGTTTTGGTATTCAACAACACCAAAGTCATGAAGGCGCGGCT
GTTTGGGCAGAAAGACAGCGGCGGCAGGATCGAAGCCCTGATTGAGCGTG
TGTTGGACAACCATACCGCATTGGCGCACATCCGTTCGTCCAAGTCCCCC
AAGCCCGGTATGGGGCTGGTGTTTGAAGGCGGTATCCGTGCCGTGATGGT
CGGGCGTGAGGGCGAACTGTTCTGCCTGCGTTTTGAAGGCGGTCAAACCG
TTTACGAACTTTTGGAACAGAACGGACACCTGCCCCTGCCGCCTTATATC
GAACGTGCCGCCGATGCGGACGACGACAGCCGTTATCAAACTGTTTATGC
CAAATATCAGGGCGCGGTCGCCGCGCCGACGGCGGGCCTGCATTTTACGG
AAGAACTTTTGCGCCGTCTGAAAGACAAAGGCGCGGTAACCGCAGAAGTA
ACCCTGCACGTCGGTGCGGGGACATTCCAACCCGTGCGCGTCGATAAAAT
CGAAGAACACAAAATGCACAGCGAATGGTTTGAAGTGCCGTCTGAAACCG
TCGCCGCCGTTGAGGCGGCAAAAGCCCGGGGGAACAAAGCCTGGGCGGTC
GGCACGACTTCCATGCGCGCCCTCGAGTCTGCCGCGCGCGCAACGGGATA
TTTGAAAGACGGACAGGGCGACACCGATATTTTCATCACGCCGGGCTACC
GTTTTAATGTTGTCGACAGGCTGGTTACCAATTTTCATCTGCCGAAATCG
ACGCTGCTGATGTTGGTCGGCGCGTTTTCGGGTATGGGTCATATCCGCGC
CGTGTACCGTCATGCGATTGAACGTGAATACCGTTTCTTCAGCTACGGAG
ATGCGATGGTTTTGGGGCGGAACGAAGGGGGCGGGCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy