Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0034 IGR0035 IGR0037 IGR0036 IGR0038 IGR0032 IGR0033 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 accC, - NG0044 carB, - NG0048 queA, - NG0047 hemL,gsa, - NG0040 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 accC, - NG0044 carB, - NG0048 queA, - NG0047 hemL,gsa, - NG0040 Type: direct, Name:  - 119 Type: direct, Name:  - 120 Type: inverse, Name:  - 184 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 accC, - NG0044 carB, - NG0048 NG0046 NG0046 queA, - NG0047 hemL,gsa, - NG0040
* Calculated from Protein Sequence

Gene ID: NG0045

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
accB  

Definition:
acetyl-Co carboxylase/biotin carboxylase carrier protein (BCCP)

Gene Start:
42618

Gene Stop:
42160

Gene Length:
459

Molecular Weight*:
15779

pI*:
4.50

Net Charge*:
-7.04

EC:
6.4.1.2  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)
Propanoate metabolism
Pyruvate metabolism
Tetracycline biosynthesis

Secondary Evidence:
Chapman-Smith A, Cronan JE Jr.
The enzymatic biotinylation of proteins: a post-translational modification of exceptional specificity.
Trends Biochem Sci. 1999 Sep;24(9):359-63. Review.
PMID: 10470036

Comment:
Oklahoma ID: NGO.45c

See NG0045 for the biotin carboxyl chain sequence.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to acetyl-CoA carboxylase (EC 6.4.1.2) biotin carboxyl carrier protein, e.g. residues 1-152 are 50% similar to BCCP_ECOLI (gb|AAG58383).

Residues 1-153 are 75% similar to NMB1860 in N.meningitidis (gb|AAF42194).

COGS Summary:  COGS Search
BeTs to 15 clades of COG0511
COG name: Biotin carboxyl carrier protein of acetyl-CoA carboxylase
Functional Class:  I
The phylogenetic pattern of COG0511 is AmtKYQvceBRhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR01071 (Acetyl-CoA biotin carboxyl carrier protein signature) with a combined E-value of 2.1e-30.
    PR01071A    82-95
    PR01071B    99-113
    PR01071C    114-127
***** IPB001882 (Biotin-requiring enzymes attachment site) with a combined E-value of 1.1e-12.
    IPB001882H    90-135
***** IPB003016 (2-oxo acid dehydrogenases acyltransferase component lipoyl binding site) with a combined E-value of 7.4e-09.
    IPB003016    101-135


ProDom Summary:  Protein Domain Search
Residues 98-152 are 74% similar to a (BIOTIN DIHYDROLIPOAMIDE PYRUVATE DEHYDROGENASE) protein domain (PD000268) which is seen in BCCP_ECOLI.

Residues 1-34 are 73% similar to a (BIOTIN CARBOXYL CARRIER PROTEIN) protein domain (PD018931) which is seen in BCCP_ECOLI.



Paralogs:  Local Blast Search


NG0045 is paralogously related to NG0564 (dihydrolipoamide S-acetyltransferase complex (E2 component of pyruvate dehydrogenase complex)) (6e-05), NG0916 (dihydrolipoamide succinyltransferase E2 component) (4e-04) and NG0562 (dihydrolipoamide dehydrogenase (pyruvate dehydrogenase, E3 component, lipoamide dehydrogenase) (glycine cleavage system L protein)) (0.001).


Pfam Summary:  Pfam Search
Residues 78 to 152 (E-value = 5.1e-33) place NG0045 in the Biotin_lipoyl family which is described as Biotin-requiring enzyme (PF00364)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
37  
73

PDB Hit:
pdb|1BDO|1BDO STRUCTURE OF THE BIOTINYL DOMAIN OF 116.0 3e-27
pdb|1A6X|1A6X STRUCTURE OF THE APO-BIOTIN CARBOXYL CARRIER 116.0 3e-27
pdb|3BDO|3BDO-A SOLUTION STRUCTURE OF APO-BIOTINYL DOMAIN FROM 116.0 3e-27
pdb|1DCZ|1DCZ-A BIOT

Gene Protein Sequence:
MDLRKLKKLIDLVEESGIAEIEVTEGEEKVRITRTIAAAAAPVYAAPVPA
AAPAVTPAAAPVAASAPAAAPAARDLSDAQKSPMVGTFYRAPGPNAAAFV
EVGQQVKAGDTLCIIEAMKLMNEIEAEKSGTVKEILVENGTPVEFGEPLF
IIG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTTGCGCAAATTAAAAAAACTGATTGATTTGGTTGAAGAATCGGG
TATCGCCGAAATCGAAGTAACCGAAGGCGAGGAAAAAGTCCGCATTACCC
GTACCATTGCAGCTGCGGCAGCTCCCGTTTACGCCGCGCCCGTACCTGCC
GCCGCGCCGGCCGTAACGCCGGCCGCCGCACCCGTTGCGGCATCCGCGCC
CGCCGCCGCGCCGGCCGCCCGCGATTTGTCCGACGCTCAAAAATCGCCTA
TGGTCGGCACGTTCTACCGCGCGCCCGGCCCGAATGCCGCCGCATTTGTC
GAAGTCGGTCAACAGGTCAAAGCCGGCGACACGCTGTGCATCATCGAAGC
GATGAAGCTGATGAACGAAATCGAAGCCGAAAAATCCGGCACGGTCAAAG
AAATTCTGGTCGAAAACGGTACGCCCGTCGAATTCGGCGAACCGCTCTTC
ATCATCGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy