Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0034 IGR0031 IGR0035 IGR0037 IGR0036 IGR0038 IGR0032 IGR0033 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 accC, - NG0044 carB, - NG0048 NG0039 queA, - NG0047 hemL,gsa, - NG0040 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 accC, - NG0044 carB, - NG0048 NG0039 queA, - NG0047 hemL,gsa, - NG0040 Type: direct, Name:  - 119 Type: direct, Name:  - 120 Type: inverse, Name:  - 184 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 accC, - NG0044 carB, - NG0048 NG0046 NG0046 queA, - NG0047 hemL,gsa, - NG0040 NG0039
* Calculated from Protein Sequence

Gene ID: NG0044

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
accC  

Definition:
acetyl-CoA carboxylase/biotin carboxylase chain

Gene Start:
42043

Gene Stop:
40685

Gene Length:
1359

Molecular Weight*:
49632

pI*:
6.60

Net Charge*:
-3.82

EC:
6.3.4.14  6.4.1.2  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)
Propanoate metabolism
Pyruvate metabolism
Tetracycline biosynthesis

Secondary Evidence:
Marini PE, Perez CA, de Mendoza D.
Growth-rate regulation of the Bacillus subtilis accBC operon encoding subunits of acetyl-CoA carboxylase, the first enzyme of fatty acid synthesis.
Arch Microbiol. 2001 Mar;175(3):234-7.
PMID: 11357516

Sloane V, Blanchard CZ, Guillot F, Waldrop GL.
Site-directed mutagenesis of ATP binding residues of biotin carboxylase: insight into the mechanism of catalysis.
J Biol Chem. 2001 May 9 [epub ahead of print]
PMID: 11346647

Comment:
Oklahoma ID: NGO.44c

See NG0045 for the associated biotin carrier protein.

Blast Summary:  PSI-Blast Search
Numerous matches to acetyl-CoA carboxylase sequences, e.g. residues 1-441 are 68% similar to ACCC_HAEIN (gb|AAC22632).

Residues 1-453 are 94% similar to NMB1861 in N.meningitidis (gb|AAF42195).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0439
COG name: Biotin carboxylase
Functional Class:  I
The phylogenetic pattern of COG0439 is amt-YQ-CeBRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001882 (Biotin-requiring enzymes attachment site) with a combined E-value of 6.5e-99.
    IPB001882A    75-95
    IPB001882B    104-132
    IPB001882C    153-170
    IPB001882D    209-244
    IPB001882E    267-281
    IPB001882F    292-301
    IPB001882G    332-350
***** IPB000901 (Carbamoyl-phosphate synthase) with a combined E-value of 3.8e-16.
    IPB000901    149-172


ProDom Summary:  Protein Domain Search
Residues 316-441 are 61% similar to a (CARBOXYLASE BIOTIN LIGASE ACETYL-COA ATP-BINDING) protein domain (PD000755) which is seen in ACCC_PSEAE.

Residues 41-315 are 73% similar to a (LIGASE SYNTHETASE CARBOXYLASE CARBAMOYL-PHOSPHATE) protein domain (PD000180) which is seen in ACCC_HAEIN.

Residues 4-33 are 86% similar to a (CARBOXYLASE BIOTIN LIGASE PYRUVATE ATP-BINDING A) protein domain (PD000820) which is seen in ACCC_ANASP.



Paralogs:  Local Blast Search


NG0044 is paralogously related to NG0048 (carbamoyl phosphate synthase large subunit (CarB)) (3e-10) and NG1531 (D-alanine--D-alanine ligase (DdlB)) (4e-04).


Pfam Summary:  Pfam Search
Residues 1 to 113 (E-value = 2.7e-55) place NG0044 in the CPSase_L_chain family which is described as Carbamoyl-phosphate synthase L chain, N-terminal domain (PF00289)
Residues 115 to 329 (E-value = 2.3e-116) place NG0044 in the CPSase_L_D2 family which is described as Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786)
Residues 336 to 441 (E-value = 7.3e-59) place NG0044 in the Biotin_carb_C family which is described as Biotin carboxylase C-terminal domain (PF02785)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
112  
197

PDB Hit:
pdb|1BNC|1BNC-A MOL_ID: 1; MOLECULE: BIOTIN CARBOXYLASE; CHAIN: 606.0 0e+00
pdb|1DV2|1DV2-A THE STRUCTURE OF BIOTIN CARBOXYLASE, MUTANT 605.0 0e+00
pdb|1CE8|1CE8-A CARBAMOYL PHOSPHATE SYNTHETASE FROM ESCHERICHIS 46.9 8e-06
pdb|1BXR|1BXR-A STRU

Gene Protein Sequence:
MLKKVLIANRGEIALRVLRACREMGIATVAVHSETDKGSLHVKLADESVC
IGPAASAQSYLNIPAIIAAAEVTCADAVHPGYGFLAENADFAEQVEQSGF
TFIGPKPDTIRLMGDKVSAKHAMIAAGVPCVPGSDGALPDDDAEILKIAD
KVGYPVIIKASGGGGGRGMRVVEKKEDLLQSVEMTKAEAGAAFGNPMVYM
ERYLQRPRHVEIQVLADEHGNAVYLAERDCSLQRRHQKVIEEAPAPFIDE
KARKKIGKACTDACKRIGYRGAGTFEFLYEDGEFFFIEMNTRVQVEHPVT
ELITGVDIVQEQLRIASGLPLQYKQKDIKIEGHAFECRINAEDPYNFIPS
PGPIESCHLPGGFGIRVDSHIYQGYRIPPYYDSLIGKICVHGKTREQAMA
KMRVALAELAVTGIKTNTPLHRDLFADAGFQEGGVSIHYLEHWLEARKTK
QDK

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGAAAAAAGTTTTAATCGCCAACCGGGGCGAAATCGCCTTGCGCGT
ACTCCGTGCCTGCCGCGAAATGGGCATTGCCACCGTTGCCGTGCATTCCG
AAACCGACAAAGGCAGCCTGCACGTCAAACTCGCCGACGAATCCGTGTGC
ATCGGTCCTGCCGCTTCTGCGCAAAGTTATCTGAACATTCCCGCCATCAT
TGCCGCCGCCGAAGTAACCTGCGCGGACGCTGTCCACCCGGGCTACGGCT
TCCTTGCCGAAAACGCCGATTTCGCCGAACAGGTCGAACAGTCCGGCTTT
ACCTTCATCGGCCCGAAACCCGACACCATCCGCCTGATGGGCGACAAAGT
CTCCGCCAAACACGCGATGATAGCGGCAGGCGTGCCCTGCGTCCCCGGCT
CTGACGGCGCATTGCCCGACGATGATGCCGAAATCCTCAAAATCGCCGAC
AAAGTCGGTTATCCCGTGATTATCAAAGCATCGGGCGGCGGCGGCGGGCG
CGGTATGCGCGTGGTCGAGAAAAAAGAAGACCTCCTCCAGTCTGTCGAAA
TGACCAAGGCTGAAGCGGGCGCGGCGTTCGGCAACCCGATGGTTTATATG
GAACGCTACCTGCAACGCCCGCGCCACGTCGAAATCCAAGTGCTTGCCGA
CGAACACGGCAACGCCGTCTATCTTGCCGAGCGCGACTGTTCGCTGCAAC
GCCGCCACCAGAAAGTCATCGAGGAAGCACCCGCCCCGTTTATCGATGAA
AAGGCACGCAAAAAAATCGGCAAAGCCTGTACCGACGCGTGCAAACGCAT
CGGCTACCGGGGCGCGGGCACGTTTGAATTTTTATACGAAGACGGCGAAT
TTTTCTTTATCGAGATGAACACGCGCGTTCAGGTCGAGCATCCGGTTACC
GAACTCATTACCGGCGTGGACATCGTCCAAGAGCAACTCCGCATCGCATC
CGGCCTGCCGCTGCAATACAAACAGAAAGACATCAAAATCGAAGGCCACG
CCTTCGAGTGCCGCATCAATGCCGAAGACCCGTACAACTTCATCCCCAGC
CCGGGCCCGATTGAAAGCTGCCACCTGCCCGGCGGCTTCGGCATCCGCGT
GGACAGCCACATCTACCAAGGCTACCGCATCCCGCCGTACTACGACAGCC
TGATCGGCAAAATCTGCGTACACGGCAAAACGCGTGAACAGGCAATGGCG
AAAATGCGCGTCGCACTCGCCGAGCTGGCGGTAACCGGCATCAAAACCAA
TACGCCGTTGCACCGCGACCTGTTCGCCGATGCGGGTTTCCAAGAAGGCG
GAGTGAGCATCCATTACCTGGAGCACTGGCTGGAAGCGCGCAAAACCAAA
CAGGACAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy