Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0034 IGR0031 IGR0035 IGR0037 IGR0036 IGR0038 IGR0032 IGR0030 IGR0033 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 NG0037 accC, - NG0044 carB, - NG0048 NG0039 queA, - NG0047 hemL,gsa, - NG0040 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 NG0037 accC, - NG0044 carB, - NG0048 NG0039 queA, - NG0047 hemL,gsa, - NG0040 Type: direct, Name:  - 119 Type: direct, Name:  - 120 Type: inverse, Name:  - 184 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 NG0037 accC, - NG0044 carB, - NG0048 NG0046 NG0046 NG0039 queA, - NG0047 hemL,gsa, - NG0040
* Calculated from Protein Sequence

Gene ID: NG0043

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
prmA  

Definition:
ribosomal protein L11 methyltransferase

Gene Start:
40578

Gene Stop:
39694

Gene Length:
885

Molecular Weight*:
31865

pI*:
4.20

Net Charge*:
-23.25

EC:
2.1.1.-  

Functional Class:
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Porphyrin and chlorophyll metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Vanet A, Plumbridge JA, Guerin MF, Alix JH.
Ribosomal protein methylation in Escherichia coli: the gene prmA, encoding the ribosomal protein L11 methyltransferase, is dispensable.
Mol Microbiol. 1994 Dec;14(5):947-58.
PMID: 7715456

Vanet A, Plumbridge JA, Alix JH.
Cotranscription of two genes necessary for ribosomal protein L11 methylation (prmA) and pantothenate transport (panF) in Escherichia coli K-12.
J Bacteriol. 1993 Nov;175(22):7178-88.
PMID: 8226664

Comment:
Oklahoma ID: NGO.43c

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to ribosomal protein L11 methyltransferase sequences, e.g. residues 1-295 are 48% similar to the enzyme in P.aeruginosa (gb|AAG08235).

Residues 1-295 are 93% similar to NMB1862 in N.meningitidis (gb|AAF42196).

COGS Summary:  COGS Search
BeTs to 6 clades of COG2264
COG name: Ribosomal protein L11 methylase
Functional Class:  J
The phylogenetic pattern of COG2264 is ----y---e-rh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 89-185 are 58% similar to a (METHYLTRANSFERASE TRANSFERASE RIBOSOMAL PROTEIN L11) protein domain (PD009497) which is seen in PRMA_ECOLI.

Residues 227-294 are 47% similar to a (METHYLTRANSFERASE TRANSFERASE PROTEIN PROBABLE RIBOSOMAL) protein domain (PD010963) which is seen in PRMA_ECOLI.

Residues 139-204 are 53% similar to a (OXIDOREDUCTASE ZINC DEHYDROGENASE ALCOHOL NAD PROTEIN) protein domain (PD000104) which is seen in O86951_THENE.



Paralogs:  Local Blast Search


NG0043 is paralogously related to NG2074 (3-demethylubiquinone-9 3-methyltransferase (UbiG)) (4e-06).


Pfam Summary:  Pfam Search
Residues 2 to 295 (E-value = 4.3e-161) place NG0043 in the PrmA family which is described as Ribosomal protein L11 methyltransferase (PrmA) (PF06325)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
176  
192

PDB Hit:
pdb|1G6Q|1G6Q-1 CRYSTAL STRUCTURE OF YEAST ARGININE 124.0 3e-29
pdb|1DUS|1DUS-A MJ0882-A HYPOTHETICAL PROTEIN FROM M. JANNASCHII118.0 9e-28
pdb|1F3L|1F3L-A CRYSTAL STRUCTURE OF THE CONSERVED CORE OF 104.0 2e-23
pdb|1KXZ|1KXZ-A MT01

Gene Protein Sequence:
MPYQQITVNVNDAVAERLADALMEHGALSAAIEDACAGTQNEQAIFGEPG
MPTEQIWQQSKVIALFGEHDEAAAVIDAAAQECGLKDLAYTGETIENQDW
VRLTQSQFDPIRISDRLWITPSWHEAPEGCAVNLRLDPGLAFGTGSHPTT
RLCLKWLDTQLKNGESVLDYGCGSGILTIAALKLGAGSAVGVDIDEQAVR
SGRDNAEQNNVDAQFFLPDSLPQGQFDVVVANILANPLRMLGEMLAARTK
QGGRIVLSGLLDEQAEELGGIYSQWFDLDPAETDEGWARLSGVKR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCTACCAACAAATCACCGTCAACGTCAACGATGCCGTCGCCGAACG
CCTCGCCGACGCGCTGATGGAACACGGTGCACTCTCCGCCGCCATCGAAG
ATGCCTGCGCCGGCACGCAAAACGAACAGGCGATTTTCGGCGAACCCGGT
ATGCCCACCGAACAAATCTGGCAGCAGAGCAAAGTCATCGCCCTGTTCGG
CGAACACGACGAAGCCGCCGCCGTCATCGATGCCGCCGCACAAGAATGCG
GGTTAAAAGACTTGGCATACACCGGCGAAACCATCGAAAACCAAGACTGG
GTGCGCCTCACGCAATCGCAATTCGACCCCATCCGAATTTCCGACCGCCT
GTGGATTACCCCCTCTTGGCACGAAGCCCCCGAAGGCTGCGCCGTCAACC
TCCGCCTCGATCCCGGACTCGCCTTCGGCACCGGCAGCCACCCGACCACG
CGCCTCTGCCTCAAATGGCTGGATACGCAACTCAAAAACGGCGAAAGCGT
CCTCGACTACGGCTGCGGTTCGGGCATCCTGACCATCGCCGCCCTCAAAC
TCGGTGCAGGTTCCGCCGTCGGCGTGGATATTGACGAACAGGCCGTCCGC
TCCGGCAGGGACAACGCCGAACAGAACAACGTCGATGCACAATTCTTCCT
GCCCGACAGTCTGCCTCAAGGGCAATTCGACGTAGTTGTCGCCAACATCC
TCGCCAACCCTTTGCGTATGCTCGGCGAAATGCTTGCAGCCCGCACCAAA
CAGGGCGGACGCATCGTGTTGTCCGGTTTGTTGGATGAACAGGCCGAAGA
ACTCGGCGGCATTTACAGCCAATGGTTCGATCTCGACCCGGCGGAAACTG
ACGAAGGCTGGGCGCGCTTGAGCGGCGTAAAACGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy