Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0034 IGR0031 IGR0035 IGR0037 IGR0036 IGR0038 IGR0032 IGR0029 IGR0030 IGR0033 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 NG0037 accC, - NG0044 carB, - NG0048 NG0039 queA, - NG0047 hemL,gsa, - NG0040 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 NG0037 accC, - NG0044 carB, - NG0048 NG0039 queA, - NG0047 hemL,gsa, - NG0040 Type: direct, Name:  - 119 Type: direct, Name:  - 120 Type: inverse, Name:  - 184 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 NG0037 accC, - NG0044 carB, - NG0048 NG0046 NG0046 NG0039 queA, - NG0047 hemL,gsa, - NG0040
* Calculated from Protein Sequence

Gene ID: NG0042

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
oligoribonuclease (3'-5' exonuclease)

Gene Start:
39673

Gene Stop:
39113

Gene Length:
561

Molecular Weight*:
21728

pI*:
5.40

Net Charge*:
-7.16

EC:
3.1.-.-  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table

Secondary Evidence:
Ghosh S, Deutscher MP.
Oligoribonuclease is an essential component of the mRNA decay pathway.
Proc Natl Acad Sci U S A. 1999 Apr 13;96(8):4372-7.
PMID: 10200269

Zhang X, Zhu L, Deutscher MP.
Oligoribonuclease is encoded by a highly conserved gene in the 3'-5' exonuclease superfamily.
J Bacteriol. 1998 May;180(10):2779-81.
PMID: 9573169

Yu D, Deutscher MP.
Oligoribonuclease is distinct from the other known exoribonucleases of Escherichia coli.
J Bacteriol. 1995 Jul;177(14):4137-9.
PMID: 7608090

Comment:
Oklahoma ID: NGO.42c

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to oligoribonucleases, e.g. residues 1-178 are 60% similar to ORN_PSEAE (gb|AAG08336).

Residues 1-187 are virtually identical to NMB1863 in N.meningitidis (gb|AAF42197).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1949
COG name: Oligoribonuclease (3'->5' exoribonuclease)
Functional Class:  F
The phylogenetic pattern of COG1949 is ----y---e-rh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 3-178 are 57% similar to a (PROTEIN OLIGORIBONUCLEASE HYDROLASE) protein domain (PD011165) which is seen in ORN_HAEIN.



Paralogs:  Local Blast Search


NG0042 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 170 (E-value = 3.7e-33) place NG0042 in the Exonuc_X-T family which is described as Exonuclease (PF00929)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1FXX|1FXX-A THE STRUCTURE OF EXONUCLEASE I SUGGESTS HOW 81.6 9e-17

Gene Protein Sequence:
VQDKNNLCWLDMEMTGLNPETDRIIEVAMIITDSDLNVLAQSEVYAIHQS
DDLLDNMDEWNTATHGRTGLTQRVRESSHTEAEVEQKLLDFMSEWIPGRA
TPMCGNSIHQDRRFMVKYMPKLENYFHYRNLDVSTLKELAKRWNPPIAKS
VVKRGSHKALDDILESIEEMRHYREHFLISAPKAEAQ

Gene Nucleotide Sequence:  Sequence Viewer
GTGCAGGACAAAAACAACCTCTGCTGGCTCGATATGGAAATGACGGGGCT
GAATCCCGAAACCGACCGCATTATCGAAGTCGCGATGATTATTACCGACT
CGGATTTGAATGTGTTGGCGCAATCCGAAGTTTACGCCATCCACCAAAGC
GACGATCTGCTCGACAATATGGACGAGTGGAACACCGCCACACACGGCAG
GACGGGGCTGACGCAGCGCGTGCGCGAATCGTCGCATACCGAAGCCGAAG
TCGAACAGAAACTGCTGGACTTTATGTCGGAATGGATACCCGGACGCGCC
ACACCGATGTGCGGCAACTCCATCCACCAAGACCGGCGTTTTATGGTCAA
ATATATGCCGAAACTGGAAAACTACTTCCACTACCGCAACCTCGACGTTT
CCACGCTGAAAGAACTCGCCAAACGCTGGAATCCGCCCATTGCCAAAAGC
GTCGTCAAACGCGGTTCGCACAAGGCATTGGACGACATTTTGGAGAGCAT
CGAAGAAATGCGCCACTACCGCGAACACTTCCTGATTTCCGCCCCGAAAG
CCGAAGCGCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy