Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0034 IGR0031 IGR0028 IGR0035 IGR0036 IGR0032 IGR0029 IGR0030 IGR0033 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 NG0037 accC, - NG0044 NG0039 xerC, - NG0035 hemL,gsa, - NG0040 dxps,dxs, - NG0036 tpn, - NG0041 accB, - NG0045 NG0042 prmA, - NG0043 NG0037 accC, - NG0044 NG0039 xerC, - NG0035 hemL,gsa, - NG0040 dxps,dxs, - NG0036 Type: direct, Name:  - 119 Type: direct, Name:  - 120 Type: inverse, Name:  - 184 tpn, - NG0041 NG0042 prmA, - NG0043 NG0037 accC, - NG0044 NG0039 xerC, - NG0035 hemL,gsa, - NG0040 dxps,dxs, - NG0036
* Calculated from Protein Sequence

Gene ID: NG0040

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemL  gsa  

Definition:
glutamate 1-semialdehyde 2,1-aminotransferase

Gene Start:
36524

Gene Stop:
37801

Gene Length:
1278

Molecular Weight*:
44999

pI*:
6.00

Net Charge*:
-6.47

EC:
5.4.3.8  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Contestabile R, Jenn T, Akhtar M, Gani D, John RA.
Reactions of glutamate 1-semialdehyde aminomutase with R- and S-enantiomers of a novel, mechanism-based inhibitor, 2,3-diaminopropyl sulfate.
Biochemistry. 2000 Mar 21;39(11):3091-6.
PMID: 10715130

Kafala B, Sasarman A.
Isolation of the Staphylococcus aureus hemCDBL gene cluster coding for early steps in heme biosynthesis.
Gene. 1997 Oct 15;199(1-2):231-9.
PMID: 9358061

Comment:
Oklahoma ID: NGO.40

For other 'hem' genes, see NG0234 and NG1580 (hemN), NG0293 (hemH), NG0360 (hemX), NG0362 (hemE), NG0385 (hemB), NG1318 (hemO), NG1403 (hemA), NG2015 (hemK).

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to glutamate-1-semialdehyde 2,1-aminomutase sequences, e.g. residues 1-424 are 59% similar to the enzyme from P.aeruginosa (X82072).

Residues 1-425 are 92% similar to NMB1864 in N.meningitidis (gb|AAF42198).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0001
COG name: Glutamate-1-semialdehyde aminotransferase
Functional Class:  H
The phylogenetic pattern of COG0001 is amt--q-ceBr-uj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000954 (Aminotransferase class-III pyridoxal-phosphate) with a combined E-value of 5.8e-50.
    IPB000954A    46-75
    IPB000954B    208-247
    IPB000954C    255-270
    IPB000954D    294-312


ProDom Summary:  Protein Domain Search
Residues 287-337 are 60% similar to a (GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE PRECURSOR EC) protein domain (PD196483) which is seen in GSA_CHLRE.

Residues 234-286 are 69% similar to a (AMINOTRANSFERASE TRANSFERASE PYRIDOXAL PHOSPHATE) protein domain (PD000465) which is seen in GSA_CHLRE.

Residues 69-307 are 63% similar to a (PYRIDOXAL PHOSPHATE AMINOTRANSFERASE TRANSFERASE PROTEIN) protein domain (PD000087) which is seen in GSA_PSEAE.

Residues 287-335 are 60% similar to a (GLUTAMATE-1-SEMIALDEHYDE 1-AMINOMUTASE GSA) protein domain (PD189086) which is seen in Q9ZMD0_BBBBB.

Residues 20-65 are 60% similar to a (AMINOTRANSFERASE PYRIDOXAL PHOSPHATE TRANSFERASE) protein domain (PD000493) which is seen in GSA_SYNY3.

Residues 107-182 are 75% similar to a (1-AMINOMUTASE GLUTAMATE-1-SEMIALDEHYDE GSA) protein domain (PD002862) which is seen in GSA_HELPY.

Residues 337-405 are 53% similar to a (1-AMINOMUTASE GLUTAMATE-1-SEMIALDEHYDE) protein domain (PD002845) which is seen in GSA_XANCH.

Residues 39-154 are 32% similar to a (AMINOTRANSFERASE TRANSFERASE DNTP-HEXOSE DEDUCED) protein domain (PD032384) which is seen in O52565_BBBBB.

Residues 33-86 are 38% similar to a (GLUTAMATE-1-SEMIALDEHYDE-2 1-AMINOMUTASE) protein domain (PD189132) which is seen in Q9Z945_BBBBB.



Paralogs:  Local Blast Search


NG0040 is paralogously related to NG0646 (acetylornithine aminotransferase (acetylornitine delta-aminotransferase) / succinylornithine transaminase (succinylornithine aminotransferase) (carbon starvation protein c)) (8e-27) and NG0308 (adenosylmethionine-8-amino-7-oxononanoate aminotransferase) (4e-20).


Pfam Summary:  Pfam Search
Residues 23 to 425 (E-value = 2.6e-100) place NG0040 in the Aminotran_3 family which is described as Aminotransferase class-III (PF00202)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
60  
132

PDB Hit:
pdb|2GSA|2GSA-A CRYSTAL STRUCTURE OF GLUTAMATE-1-SEMIALDEHYDE 450.0 0e+00
pdb|1D7R|1D7R-A CRYSTAL STRUCTURE OF THE COMPLEX OF 138.0 3e-33
pdb|1DGD|1DGD DIALKYLGLYCINE DECARBOXYLASE (PYRUVATE) (DGD) 138.0 3e-33
pdb|1DKA|1DKA 2,2-D

Gene Protein Sequence:
MNRNEILFDRAKAIIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVWDENGT
RYTDYVGSWGPAIVGHAHPEVVEAVREAALGGLSFGAPTEGEIAIAEQIA
EIMPSVERLRLVSSGTEATMTAIRLARGFTGRDKIIKFEGCYHGHSDSLL
VKAGSGLLTFGNPSSAGVPADFTKHTLVLEYNNIAQLEEAFAQSGDEIAC
VIVEPFVGNMNLVRPTEAFVKALRGLTEKHGAVLIYDEVMTGFRVALGGA
QSLHGITPDLTTMGKVIGGGMPLAAFGGRKDIMECISPLGGVYQAGTLSG
NPIAVAAGLKTLEIIQREGFYENLTALTQRLANGIAAAKAHGIEFAADSV
GGMFGLYFAAHVPRNYADMARSNIDAFKRFFHGMLDRGIAFGPSAYEAGF
VSAAHTPELIDETVAVAVEVFKAMAA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCGTAACGAAATTTTATTCGACCGCGCCAAGGCCATCATCCCCGG
CGGCGTGAATTCGCCCGTGCGCGCATTCGGCAGCGTCGGCGGCGTGCCGC
GCTTCATCAAAAAAGCCGAAGGCGCGTATGTTTGGGACGAAAACGGCACG
CGCTACACCGATTATGTCGGCTCTTGGGGGCCTGCGATTGTCGGACACGC
GCATCCCGAAGTCGTCGAAGCCGTGCGCGAAGCTGCGTTGGGCGGTTTGT
CGTTCGGCGCGCCCACCGAAGGCGAAATCGCCATTGCCGAACAAATTGCC
GAAATTATGCCGTCTGTCGAACGGCTGCGCCTCGTCAGCTCCGGCACGGA
AGCGACGATGACTGCCATCCGTCTGGCACGCGGTTTTACCGGCCGCGACA
AAATCATCAAATTTGAAGGCTGCTACCACGGCCATTCCGACAGCCTGTTG
GTGAAAGCAGGCAGCGGTCTGCTTACCTTCGGCAATCCTTCTTCCGCCGG
TGTGCCTGCCGACTTTACCAAACATACTTTGGTACTCGAATACAACAACA
TCGCCCAACTCGAAGAAGCCTTTGCCCAAAGCGGCGACGAAATCGCCTGC
GTGATTGTCGAACCCTTCGTCGGCAATATGAACCTCGTCCGCCCGACCGA
AGCCTTTGTCAAAGCCTTGCGCGGATTGACCGAAAAACACGGCGCGGTGT
TGATTTACGACGAAGTGATGACCGGTTTCCGCGTCGCGCTCGGCGGCGCG
CAGTCGCTGCACGGCATCACGCCCGACCTGACCACGATGGGCAAAGTCAT
CGGCGGCGGTATGCCGCTTGCCGCGTTCGGCGGACGCAAAGACATCATGG
AATGTATTTCCCCGTTGGGCGGCGTGTATCAGGCAGGTACATTATCAGGC
AACCCGATTGCCGTCGCCGCCGGCTTGAAAACGCTGGAAATCATCCAGCG
CGAAGGCTTCTATGAAAACCTGACCGCCTTGACACAACGCCTTGCCAACG
GTATTGCCGCCGCCAAAGCGCACGGTATCGAGTTTGCCGCCGACAGCGTG
GGCGGTATGTTCGGTCTGTATTTCGCCGCACACGTGCCGCGAAACTATGC
CGATATGGCGCGCTCCAATATCGACGCTTTCAAACGCTTCTTCCACGGCA
TGCTCGACCGCGGCATTGCCTTCGGCCCGTCCGCTTATGAAGCGGGTTTC
GTTTCCGCCGCGCATACGCCCGAGCTGATTGACGAAACGGTTGCGGTTGC
GGTTGAAGTGTTCAAGGCGATGGCTGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy