Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0031 IGR0028 IGR0026 IGR0025 IGR0027 IGR0032 IGR0029 IGR0030 tpn, - NG0041 NG0032 NG0033 alf,tsr, - NG0034 NG0037 NG0039 xerC, - NG0035 hemL,gsa, - NG0040 dxps,dxs, - NG0036 tpn, - NG0041 NG0032 NG0033 alf,tsr, - NG0034 NG0037 NG0039 xerC, - NG0035 hemL,gsa, - NG0040 dxps,dxs, - NG0036 Type: tandem, Name:  - 4 Type: direct, Name:  - 119 Type: direct, Name:  - 120 tpn, - NG0041 NG0032 NG0033 alf,tsr, - NG0034 NG0037 NG0039 xerC, - NG0035 hemL,gsa, - NG0040 dxps,dxs, - NG0036
* Calculated from Protein Sequence

Gene ID: NG0036

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dxps  dxs  

Definition:
1-deoxyxylulose-5-phosphate synthase (DXP synthase)

Gene Start:
32252

Gene Stop:
34162

Gene Length:
1911

Molecular Weight*:
68804

pI*:
6.20

Net Charge*:
-8.74

EC:
4.1.3.37  

Functional Class:
Central intermediary metabolism; Pyruvate metabolism  

Pathway: pathway table

Secondary Evidence:
Harker M, Bramley,P.M.
Expression of prokaryotic 1-deoxy-D-xylulose-5-phosphatases in Escherichia coli increases carotenoid and ubiquinone biosynthesis.
FEBS Lett. 1999 Apr 1;448(1):115-9.
PMID: 10217421

Eisenreich W, Schwarz M, Cartayrade A, Arigoni D, Zenk MH, Bacher A.
The deoxyxylulose phosphate pathway of terpenoid biosynthesis in plants and microorganisms.
Chem Biol. 1998 Sep;5(9):R221-33. Review.
PMID: 9751645

Comment:
This enzyme catalyzes the first step in the nonmevalonate pathway of terpenoid synthesis.

Oklahoma ID: NGO.36

Blast Summary:  PSI-Blast Search
Numerous hits in gappped BLAST to 1-deoxyxylulose-5-phosphate synthase sequences, e.g. residues 4-630 are 53% similar to the enzyme from P. aeruginosa (gb|AAG07431).

Residues 1-637 are 90% similar to the enzyme from N.meningitidis (gb|AAF42201).

COGS Summary:  COGS Search
BeTs to 10 clades of COG1154
COG name: Deoxyxylulose-5-phosphate synthase
Functional Class:  H,I
The phylogenetic pattern of COG1154 is -m---qVcebRhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000360 (Transketolase) with a combined E-value of 6.5e-42.
    IPB000360A    44-55
    IPB000360B    384-423
    IPB000360C    435-464
***** IPB001017 (Dehydrogenase, E1 component) with a combined E-value of 1.2e-06.
    IPB001017D    145-183


ProDom Summary:  Protein Domain Search
Residues 370-567 are 65% similar to a (PYRUVATE DEHYDROGENASE THIAMINE PYROPHOSPHATE E1 SUBUNIT) protein domain (PD000580) which is seen in DXS_HAEIN.

Residues 7-69 are 69% similar to a (SYNTHASE 1-DEOXYXYLULOSE-5-PHOSPHATE DXP) protein domain (PD005882) which is seen in DXS_HAEIN.

Residues 71-357 are 43% similar to a (SYNTHASE 1-DEOXYXYLULOSE-5-PHOSPHATE DXP FLAVOPROTEIN) protein domain (PD003097) which is seen in O64904_MENPI.



Paralogs:  Local Blast Search
NG0036 is paralogously related to NG1028 (transketolase) (2e-09).


Pfam Summary:  Pfam Search
Residues 330 to 493 (E-value = 1.9e-61) place NG0036 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)
Residues 506 to 622 (E-value = 1.9e-39) place NG0036 in the Transketolase_C family which is described as Transketolase, C-terminal domain (PF02780)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
112  
174
coil-coil  
225  
252
transmembrane  
517  
533
non-globular  
544  
637

PDB Hit:
pdb|1IK6|1IK6-A 3D STRUCTURE OF THE E1BETA SUBUNIT OF PYRUVATE 70.6 8e-13
pdb|1QS0|1QS0-B CRYSTAL STRUCTURE OF PSEUDOMONAS PUTIDA 58.9 3e-09
pdb|1TKA|1TKA-A TRANSKETOLASE (E.C.2.2.1.1) COMPLEXED WITH 44.1 7e-05
pdb|1AY0|1AY0-A I

Gene Protein Sequence:
MNPSPLLHLIDSPQDLRRLDKKQLPRLAGELRAFLLESVGQTGGHFASNL
GAVELTIALHYVYDTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGL
AGFPKRCESEYDAFGVGHSSTSIGAALGMAAADKLLGGDRRSVAIIGDGA
MTAGQAFEALNCAGDMDVDLLVVLNDNEMSISPNVGALPKYLASNVVRDM
HGLLSTVKAQTGKVLDKIPGAMEFAQKVEHKIKTLAEEAEHAKQSLSLFE
NFGFRYTGPVDGHNVENLVDVLKDLRSRKGPQLLHVITKKGNGYKLAEND
PVKYHAVANLPKEGGAQMPSEKEPKPAAKPTYTQVFGKWLCDRAAADSRL
VAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLACEGMKPVV
AIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDLSF
LRCVPNMIVAAPSDENECRLLLSTCYQADAPAAVRYPRGTGTGAPVSDGM
ETVEIGKGIIRREGEKTAFIAFGSMVATALAVAEKLNATVADMRFVKPID
EELIVRLARSHDRIVTLEENAEQGGAGGAVLEVLAKHGICKPVLLLGVAD
TVTEHGDPKKLLDDLGLSAEAVERRVREWLPDRDAAN

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCCAAGCCCCCTACTCCACCTGATTGACAGCCCGCAAGATTTGCG
CCGCCTGGACAAAAAACAGCTGCCGCGCCTTGCCGGCGAGTTGCGCGCCT
TTCTGCTGGAATCTGTCGGGCAGACCGGCGGGCATTTCGCCAGCAATCTG
GGTGCGGTCGAACTGACCATCGCCCTGCACTATGTGTACGACACGCCCGA
AGACAAGCTGGTGTGGGATGTCGGACACCAAAGCTACCCGCACAAAATCC
TGACAGGCAGGAAAAACCAGATGCACACCATGCGCCAATACGGCGGTTTG
GCGGGTTTTCCGAAACGTTGCGAGTCCGAGTACGACGCGTTCGGCGTGGG
GCATTCCTCCACCTCCATCGGCGCGGCTTTGGGCATGGCGGCGGCGGACA
AACTCTTGGGCGGCGACCGCCGCAGCGTCGCCATCATCGGAGACGGCGCG
ATGACGGCGGGGCAGGCGTTTGAAGCCTTGAATTGCGCGGGCGATATGGA
TGTGGATTTGCTGGTCGTCCTCAACGACAACGAAATGTCGATTTCCCCCA
ACGTCGGCGCGTTGCCCAAATATCTTGCCAGCAACGTCGTGCGCGATATG
CACGGACTGTTGAGTACCGTCAAAGCGCAAACGGGCAAGGTATTAGACAA
AATACCCGGCGCGATGGAGTTTGCCCAAAAAGTCGAACACAAAATCAAAA
CCCTTGCCGAAGAAGCCGAACACGCCAAACAGTCGCTGTCGCTGTTTGAA
AATTTCGGCTTCCGCTACACCGGCCCCGTGGACGGACACAACGTCGAGAA
TCTGGTGGACGTATTGAAAGACTTGCGCAGCCGCAAAGGCCCTCAGTTGC
TGCACGTCATCACCAAAAAGGGCAACGGCTACAAACTCGCCGAAAACGAC
CCCGTCAAATACCACGCCGTCGCCAACCTGCCTAAAGAAGGCGGGGCGCA
AATGCCGTCTGAAAAAGAACCCAAGCCCGCCGCCAAACCGACCTATACCC
AAGTATTCGGCAAATGGCTGTGCGACCGGGCGGCGGCAGATTCCCGACTG
GTTGCGATTACCCCCGCCATGCGCGAGGGCAGCGGACTGGTGGAGTTTGA
ACAACGATTCCCCGACCGCTATTTCGATGTCGGCATCGCCGAGCAGCACG
CCGTTACCTTTGCCGGCGGTTTGGCGTGCGAAGGCATGAAGCCCGTCGTG
GCGATTTATTCCACCTTTTTACAACGCGCCTACGACCAACTGGTGCACGA
CATCGCCCTGCAAAACCTGCCCGTTTTGTTTGCCGTCGACCGTGCGGGCA
TCGTCGGCGCGGACGGTCCGACCCATGCCGGCTTGTACGATTTGAGCTTC
TTGCGCTGTGTGCCGAACATGATTGTTGCCGCGCCGAGCGATGAAAACGA
ATGCCGCCTGCTGCTTTCGACCTGCTATCAGGCGGATGCGCCCGCCGCCG
TCCGCTATCCGCGCGGCACGGGTACGGGCGCGCCGGTTTCAGACGGCATG
GAAACCGTGGAAATCGGCAAGGGCATTATCCGCCGCGAAGGTGAGAAAAC
CGCCTTCATTGCCTTCGGCAGTATGGTCGCCACCGCATTGGCGGTTGCCG
AAAAACTGAACGCCACCGTCGCCGATATGCGCTTCGTCAAACCGATAGAC
GAAGAGTTGATTGTCCGCCTTGCCCGAAGCCACGACCGCATCGTTACCCT
TGAAGAAAACGCCGAACAGGGCGGCGCAGGCGGCGCGGTCTTGGAAGTGT
TGGCGAAACACGGCATCTGCAAACCCGTTTTGCTTTTGGGCGTTGCCGAT
ACCGTAACCGAACACGGCGATCCGAAAAAACTTTTGGACGATTTGGGTTT
GAGTGCCGAAGCGGTGGAACGCCGGGTGCGCGAGTGGCTGCCGGACCGTG
ATGCGGCAAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy