Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0024 IGR0023 IGR0028 IGR0026 IGR0025 IGR0027 IGR0029 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0033 alf,tsr, - NG0034 argA, - NG0027 NG0037 xerC, - NG0035 dxps,dxs, - NG0036 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0033 alf,tsr, - NG0034 argA, - NG0027 NG0037 xerC, - NG0035 dxps,dxs, - NG0036 Type: tandem, Name:  - 4 pyrE, - NG0029 NG0032 NG0030 NG0033 alf,tsr, - NG0034 argA, - NG0027 NG0037 rimI, - NG0031 rimI, - NG0031 NG0028 xerC, - NG0035 dxps,dxs, - NG0036
* Calculated from Protein Sequence

Gene ID: NG0034

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
alf  tsr  

Definition:
fructose-1,6-bisphosphate aldolase

Gene Start:
31056

Gene Stop:
29995

Gene Length:
1062

Molecular Weight*:
38300

pI*:
6.00

Net Charge*:
-7.28

EC:
4.1.2.13  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Fructose and mannose metabolism
Glycolysis / Gluconeogenesis
Pentose phosphate cycle

Comment:
Oklahoma ID: NGO.34c

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to fructose-1,6-bisphosphate aldolase sequences, e.g. residues 1-350 are 75% similar to the enzyme in P.aeruginosa (gb|AAG03944).

Residues 1-354 are 95% similar to the NMA0587 enzyme in N.meningitidis (AL162753).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0191
COG name: Fructose/tagatose biphosphate aldolases
Functional Class:  G
The phylogenetic pattern of COG0191 is ----yqvcEBrhujgpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000771 (Fructose-bisphosphate aldolase, class-II) with a combined E-value of 3.2e-91.
    IPB000771A    13-51
    IPB000771B    76-87
    IPB000771C    117-153
    IPB000771D    190-202
    IPB000771E    252-283
    IPB000771F    295-312


ProDom Summary:  Protein Domain Search
Residues 2-329 are 75% similar to a (ALDOLASE LYASE FRUCTOSE-BISPHOSPHATE ZINC GLYCOLYSIS) protein domain (PD002376) which is seen in O87796_PSEST.



Paralogs:  Local Blast Search


NG0034 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 329 (E-value = 4.4e-158) place NG0034 in the F_bP_aldolase family which is described as Fructose-bisphosphate aldolase class-II (PF01116)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
41

PDB Hit:
pdb|1GVF|1GVF-A STRUCTURE OF TAGATOSE-1,6-BISPHOSPHATE ALDOLASE 168.0 2e-42
pdb|1B57|1B57-A CLASS II FRUCTOSE-1,6-BISPHOSPHATE ALDOLASE IN 67.9 3e-12
pdb|1DOS|1DOS-A STRUCTURE OF FRUCTOSE-BISPHOSPHATE ALDOLASE 65.6 1e-11
pdb|1GVF|1GVF-A STRU

Gene Protein Sequence:
MALVSMRQLLDHAAENSYGLPAFNVNNLEQMRAIMEAADQVNAPVIVQAS
AGARKYAGAPFLRHLILAAVEEFPHIPVVMHQDHGASPDVCQRSIQLGFS
SVMMDGSLLEDGKTPSSYEYNVNATRTVVNFSHACGVSVEGEIGVLGNLE
TGEAGEEDGVGAAGKLSHDQMLTSVEDAVRFVKDTGVDALAIAVGTSHGA
YKFTRPPTGDVLRIDRIKEIHQALPNTHIVMHGSSSVPQEWLKVINEYGG
NIGETYGVPVEEIVEGIKHGVRKVNIDTDLRLASTGAVRRYLAENPSDFD
PRKYLGKTIEAMKQICLDRYLAFGCEGQAGKIKPVSLEKMASRYAKGELN
QIVK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACTCGTATCCATGCGCCAACTGCTTGACCACGCCGCCGAAAACAG
CTACGGCCTGCCCGCGTTCAACGTCAACAACCTCGAACAAATGCGCGCCA
TTATGGAAGCCGCCGACCAAGTCAACGCGCCCGTCATCGTACAGGCGAGC
GCAGGTGCGCGCAAATACGCGGGCGCGCCGTTTTTGCGCCACCTGATTCT
GGCGGCAGTCGAAGAATTTCCGCACATCCCCGTCGTGATGCACCAAGACC
ACGGCGCATCGCCCGACGTGTGCCAACGCTCCATCCAACTGGGCTTCTCC
TCCGTGATGATGGACGGCTCTTTGCTCGAAGACGGCAAAACCCCTTCTTC
TTACGAATACAACGTCAACGCCACCCGTACCGTCGTCAACTTCTCCCACG
CCTGCGGCGTGTCCGTCGAAGGCGAAATCGGCGTATTGGGCAACCTCGAA
ACCGGCGAAGCAGGCGAAGAAGACGGAGTGGGCGCGGCAGGCAAACTCTC
ACACGACCAAATGCTCACCAGCGTTGAAGATGCCGTGCGTTTCGTTAAAG
ATACCGGCGTTGACGCATTGGCGATTGCCGTCGGCACCAGCCACGGCGCA
TACAAATTCACCCGTCCGCCCACAGGCGACGTATTGCGTATCGACCGCAT
CAAGGAAATCCACCAAGCCCTGCCCAATACACACATCGTGATGCACGGCT
CCAGCTCCGTTCCGCAAGAATGGCTGAAAGTCATCAACGAATACGGCGGC
AATATCGGCGAAACCTACGGCGTGCCGGTTGAAGAAATCGTCGAAGGCAT
CAAACACGGCGTGCGCAAAGTCAACATCGATACCGACCTGCGCCTCGCTT
CCACCGGCGCGGTACGCCGCTACCTTGCCGAAAACCCGTCCGACTTTGAT
CCGCGCAAATACTTGGGCAAAACCATTGAAGCGATGAAGCAAATCTGCCT
CGACCGTTATCTTGCGTTCGGTTGCGAAGGTCAGGCAGGCAAAATCAAAC
CTGTTTCGTTGGAAAAAATGGCAAGCCGTTATGCCAAGGGCGAATTGAAC
CAAATCGTCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy