Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0024 IGR0023 IGR0028 IGR0022 IGR0026 IGR0025 IGR0027 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0033 alf,tsr, - NG0034 argA, - NG0027 NG0026 xerC, - NG0035 dxps,dxs, - NG0036 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0033 alf,tsr, - NG0034 argA, - NG0027 NG0026 xerC, - NG0035 dxps,dxs, - NG0036 Type: tandem, Name:  - 4 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0033 alf,tsr, - NG0034 argA, - NG0027 NG0026 rimI, - NG0031 rimI, - NG0031 xerC, - NG0035 dxps,dxs, - NG0036
* Calculated from Protein Sequence

Gene ID: NG0031

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rimI  

Definition:
ribosome-protein-alanine acetyltransferase

Gene Start:
28183

Gene Stop:
27746

Gene Length:
438

Molecular Weight*:
16053

pI*:
5.70

Net Charge*:
-2.52

EC:
2.3.1.128  

Functional Class:
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table

Secondary Evidence:
Yoshikawa,A., Isono,S., Sheback,A. and Isono,K.
Cloning and nucleotide sequencing of the genes rimI and rimJ which
encode enzymes acetylating ribosomal proteins S18 and S5 of
Escherichia coli K12.
Mol. Gen. Genet. 209 (3), 481-488 (1987).
MEDLINE: 88121676

Comment:
Oklahoma ID: NGO.31c

Blast Summary:  PSI-Blast Search
Numerous hits to acetyltransferases, in particular ribosome-protein-alanine acetyltransferase, e.g. residues 9-142 are 37% similar to the enzyme from E.coli ( gb|AAG59553).

Residues 1-146 are 86% similar to the enzyme from N.meningitidis (gb|AAF42206).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0456
COG name: Acetyltransferases
Functional Class:  R
The phylogenetic pattern of COG0456 is amtkYqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 48-129 are 46% similar to a (PROTEIN TRANSFERASE ACETYLTRANSFERASE ACYLTRANSFERASE) protein domain (PD000189) which is seen in RIMI_ECOLI.



Paralogs:  Local Blast Search


NG0031 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 43 to 120 (E-value = 1.2e-18) place NG0031 in the Acetyltransf_1 family which is described as Acetyltransferase (GNAT) family (PF00583)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNIRPASPSDCAALAALDTVCNPSAWTQRQFESALVSPSEQVFLAEKDGR
IAAFIVWQNLPDESELHLIATAPECRRRGVASALLEYWYAHLPEGTQRLL
LEVRAGNAAAQALYTKHGFSIAGRRKNYYCAADGQTEDAVLMEKIC

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACATCCGCCCAGCCTCACCGTCCGACTGCGCCGCACTGGCCGCGCT
CGATACCGTCTGCAACCCGTCCGCGTGGACGCAACGCCAATTTGAGTCCG
CGCTTGTTTCGCCGTCCGAACAGGTTTTCCTTGCGGAAAAAGACGGCAGG
ATTGCCGCCTTTATCGTTTGGCAGAACCTGCCCGACGAATCCGAACTGCA
CCTGATTGCCACCGCGCCCGAATGCCGCCGACGGGGCGTTGCGTCCGCCC
TGCTCGAATATTGGTACGCACATCTGCCCGAAGGCACGCAACGCCTGCTG
CTCGAAGTCCGCGCAGGCAACGCCGCCGCACAGGCACTGTATACCAAACA
CGGCTTCAGCATTGCGGGCAGGCGGAAAAACTATTACTGCGCCGCCGACG
GGCAAACCGAAGATGCCGTCTTAATGGAGAAAATATGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy