Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0024 IGR0023 IGR0022 IGR0021 IGR0026 IGR0025 IGR0027 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0033 alf,tsr, - NG0034 argA, - NG0027 NG0026 xerC, - NG0035 NG0025 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0033 alf,tsr, - NG0034 argA, - NG0027 NG0026 xerC, - NG0035 NG0025 Type: tandem, Name:  - 4 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0033 alf,tsr, - NG0034 argA, - NG0027 NG0026 rimI, - NG0031 rimI, - NG0031 xerC, - NG0035 NG0025
* Calculated from Protein Sequence

Gene ID: NG0029

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyrE  

Definition:
orotate phosphoribosyltransferase (OPRT)

Gene Start:
26950

Gene Stop:
26312

Gene Length:
639

Molecular Weight*:
23253

pI*:
9.60

Net Charge*:
2.00

EC:
2.4.2.10  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Neuhard,J., Stauning,E. and Kelln,R.A.
Cloning and characterization of the pyrE gene and of PyrE::Mud1 (Aplac) fusions from Salmonella typhimurium.
Eur. J. Biochem. 146 (3), 597-603 (1985).
MEDLINE: 85126988


MacGregor CH, Arora SK, Hager PW, Dail MB, Phibbs PV Jr.
The nucleotide sequence of the Pseudomonas aeruginosa pyrE-crc-rph region and the purification of the crc gene product.
J Bacteriol. 1996 Oct;178(19):5627-35.
PMID: 8824606


Comment:
Oklahoma ID: NGO.29c


For other 'pyr' genes, see NG1876 (pyrI), NG0255 (pyrC), NG0401 (pyrF), NG0589 (pyrP), NG1212 (pyrG), NG1761 (pyrD), NG1973 (pyrH).

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to orotate phosphoribosyltransferase sequences, e.g. residues 1-212 are 53% similar to the enzyme in P.aeruginosa (gb|AAG08716).

Residues 1-213 are 92% similar to the enzyme in N.meningitidis (gb|AAF42208).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0461
COG name: Orotate phosphoribosyltransferase
Functional Class:  F
The phylogenetic pattern of COG0461 is amtkYqvcebrhuj-----n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002375 (Purine/pyrimidine phosphoribosyl transferase) with a combined E-value of 2.6e-06.
    IPB002375A    98-102
    IPB002375B    116-131


ProDom Summary:  Protein Domain Search
Residues 111-180 are 64% similar to a (TRANSFERASE GLYCOSYLTRANSFERASE) protein domain (PD000249) which is seen in PYRE_PSEAE.

Residues 8-103 are 53% similar to a (TRANSFERASE GLYCOSYLTRANSFERASE OROTATE) protein domain (PD001420) which is seen in PYRE_ECOLI.



Paralogs:  Local Blast Search


NG0029 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 36 to 169 (E-value = 1.6e-28) place NG0029 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
174  
190

PDB Hit:
pdb|1LH0|1LH0-A CRYSTAL STRUCTURE OF SALMONELLA TYPHIMURIUM OMP 237.0 1e-63
pdb|1ORO|1ORO-A A FLEXIBLE LOOP AT THE DIMER INTERFACE IS A PART237.0 1e-63
pdb|1STO|1STO OROTATE PHOSPHORIBOSYLTRANSFERASE (OPRTASE) 235.0 6e-63
pdb|1LH0|1LH0-A CRYS

Gene Protein Sequence:
MTDFRQDFLKFSLAQNVLKFGEFTTKAGRRSPYFFNAGLFNDGASTLQLA
KFYAQSIIESGIRFDMLFGPAYKGIILAAATAMMLAEKGVNVPFAYNRKE
AKDRGEGGVLVGAPLKGRVLIIDDVISAGTSVRESIKLIEAEGATPAGVA
IALDRMEKGTGKLSAVQEVEKQYGLPVAPIASLNDLFILLQNNPEFGQFL
EPVRTYRRQYGVE

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGATTTCCGCCAAGATTTCCTCAAATTCTCCCTCGCCCAAAATGT
TTTGAAATTCGGCGAATTTACCACCAAAGCCGGACGGCGGTCGCCCTATT
TCTTCAATGCCGGCCTCTTCAACGACGGCGCGTCCACGCTGCAACTGGCA
AAATTCTATGCACAATCCATCATTGAAAGCGGCATCCGATTCGATATGCT
GTTCGGCCCCGCCTACAAAGGCATTATTTTGGCGGCGGCAACCGCGATGA
TGCTGGCGGAAAAAGGCGTGAACGTCCCGTTTGCCTACAACCGCAAAGAA
GCCAAAGACCGCGGCGAAGGCGGCGTGTTGGTCGGCGCGCCGCTTAAAGG
GCGCGTGCTGATTATCGACGACGTGATTTCCGCCGGCACATCCGTACGCG
AATCAATCAAACTGATTGAAGCGGAGGGTGCAACCCCCGCCGGTGTCGCC
ATCGCGCTCGACCGCATGGAAAAAGGCACGGGTAAATTGTCCGCCGTTCA
GGAAGTGGAAAAACAATACGGCCTGCCCGTCGCCCCCATCGCCAGCCTGA
ACGATTTGTTTATCCTGTTGCAAAACAACCCCGAATTCGGACAGTTCCTC
GAACCCGTCCGCACCTACCGCCGGCAGTACGGCGTAGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy