Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0024 IGR0023 IGR0020 IGR0022 IGR0021 IGR0026 IGR0025 NG0024 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0033 NG0023 alf,tsr, - NG0034 argA, - NG0027 NG0026 NG0025 NG0024 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0033 NG0023 alf,tsr, - NG0034 argA, - NG0027 NG0026 NG0025 Type: tandem, Name:  - 3 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0033 NG0023 alf,tsr, - NG0034 argA, - NG0027 NG0026 rimI, - NG0031 rimI, - NG0031 NG0024 NG0025
* Calculated from Protein Sequence

Gene ID: NG0027

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
argA  

Definition:
N-acetylglutamate synthetase; amino acid N-acetyltransferase

Gene Start:
25816

Gene Stop:
24509

Gene Length:
1308

Molecular Weight*:
46991

pI*:
6.80

Net Charge*:
-1.60

EC:
2.3.1.1  2.7.2.8  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Urea cycle and metabolism of amino groups

Secondary Evidence:
Rajagopal,B.S., DePonte,J. III, Tuchman,M. and Malamy,M.H.
Use of inducible feedback-resistant N-acetylglutamate synthetase
(argA) genes for enhanced arginine biosynthesis by genetically
engineered Escherichia coli K-12 strains.
Appl. Environ. Microbiol. 64 (5), 1805-1811 (1998).
Medline: 98247316.

Charlier D, Roovers M, Van Vliet F, Boyen A, Cunin R, Nakamura Y, Glansdorff N, Pierard A.
Arginine regulon of Escherichia coli K-12. A study of repressor-operator interactions and of in vitro binding affinities versus in vivo repression.
J Mol Biol. 1992 Jul 20;226(2):367-86.
PMID: 1640456

Rajagopal BS, DePonte J 3rd, Tuchman M, Malamy MH.
Use of inducible feedback-resistant N-acetylglutamate synthetase (argA) genes for enhanced arginine biosynthesis by genetically
engineered Escherichia coli K-12 strains.
Appl Environ Microbiol. 1998 May;64(5):1805-11.
PMID: 9572954

Comment:
See also: ArgB, NG0844; ArgC, NG0118, ArgD, NG0646; ArgF, NG1232; ArgG, NG1961; ArgH, NG0219, ArgJ, NG1194.

Oklahoma ID: NGO.27c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to N-acetylglutamate synthetases, e.g. residues 8-420 are 40% similar to the enzyme in E.coli (gb|AAC23447).

Residues 1-436 are virtually identical to a predicted acetylglutamate synthase in N.meningitidis (gb|AAF42210).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0548
COG name: Acetylglutamate kinase
Functional Class:  E
The phylogenetic pattern of COG0548 is amtkyqvcEbr----------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 162-284 are 36% similar to a (KINASE TRANSFERASE BIOSYNTHESIS ASPARTOKINASE GLUTAMATE) protein domain (PD000447) which is seen in ARGA_ECOLI.

Residues 91-253 are 26% similar to a (PUTATIVE AMINO-ACID ACETYLTRANSFERASE) protein domain (PD215070) which is seen in O81008_ARATH.

Residues 328-405 are 43% similar to a (PROTEIN TRANSFERASE ACETYLTRANSFERASE ACYLTRANSFERASE) protein domain (PD000189) which is seen in O81008_ARATH.



Paralogs:  Local Blast Search


NG0027 is paralogously related to NG0844 (acetylglutamate kinase (NAGB)) (9e-22).


Pfam Summary:  Pfam Search
Residues 24 to 260 (E-value = 1.2e-05) place NG0027 in the AA_kinase family which is described as Amino acid kinase family (PF00696)
Residues 329 to 405 (E-value = 1.5e-09) place NG0027 in the Acetyltransf_1 family which is described as Acetyltransferase (GNAT) family (PF00583)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
44  
60
non-globular  
187  
292

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNAPDSFVAHFREAAPYIRQMRGTTLVAGIDGRLLEGGTLNKLAADIGLL
SQLGIRLVLIHGAYHFLDRLAAAQGRTPHYCRGLRVTDETSLGQAQQFAG
TVRSRFEAALCGSVSGFARAPSVPLVSGNFLTARPIGVIDGTDMEYAGVI
RKTDTAALRFQLDAGNIVWMPPLGHSYGGKTFNLDMVQAAASVAVSLQAE
KLVYLTLSDGISRPDGTLAETLSAQEAQSLAEHAASETRRLISSAVAALE
GGVHRVQILNGAADGSLLQELFTRNGIGTSIAKEAFVSIRQAHSGDIPHI
AALIRPLEEQGVLLHRSREYLENHISEFSILEHDGDLYGCAALKTFAEAD
CGEIACLAVSPQAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWFA
ERGFQTASEDELPETRRKDYRSNGRNPHILVRRLHR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGCGCCCGACAGCTTTGTCGCCCACTTCCGCGAAGCCGCCCCCTA
CATCCGCCAAATGCGCGGCACGACACTGGTCGCCGGCATAGACGGCCGCC
TGCTCGAAGGCGGCACCTTAAATAAGCTCGCCGCCGACATCGGGCTGTTG
TCGCAACTGGGCATCCGACTCGTCCTCATCCACGGCGCGTACCACTTCCT
CGACCGCCTCGCCGCCGCGCAAGGCCGCACGCCGCATTATTGCCGGGGTT
TGCGCGTTACCGACGAAACCTCGCTCGGACAGGCGCAGCAGTTTGCCGGC
ACCGTCCGCAGCCGTTTTGAAGCCGCATTGTGCGGCAGCGTTTCAGGATT
CGCGCGCGCGCCTTCCGTCCCGCTCGTATCGGGCAACTTCCTGACCGCCC
GTCCGATAGGCGTGATTGACGGAACCGATATGGAATACGCGGGCGTTATC
CGCAAAACCGACACCGCCGCCCTCCGTTTCCAACTCGACGCGGGCAATAT
CGTCTGGATGCCGCCGCTCGGGCATTCCTACGGCGGCAAAACCTTCAATC
TCGATATGGTGCAGGCCGCCGCTTCCGTCGCCGTCTCGCTTCAGGCCGAA
AAACTCGTTTACCTGACCCTTTCAGACGGCATTTCCCGCCCCGACGGCAC
GCTCGCCGAAACCCTCTCGGCACAGGAAGCGCAATCGCTGGCGGAACACG
CCGCCAGCGAAACCCGACGACTGATTTCGTCCGCCGTTGCCGCGCTCGAA
GGCGGCGTGCATCGCGTCCAAATCCTCAACGGGGCCGCCGACGGCAGCCT
GCTGCAAGAACTCTTCACCCGCAACGGCATCGGCACGTCCATTGCCAAAG
AAGCCTTCGTCTCCATCCGGCAGGCGCACAGCGGCGACATCCCGCACATC
GCCGCCCTCATCCGCCCGCTGGAAGAACAGGGCGTCCTATTGCACCGCAG
CCGCGAATACCTCGAAAACCACATTTCCGAATTTTCCATCCTCGAACACG
ACGGCGACCTGTACGGCTGTGCCGCACTCAAAACCTTTGCCGAAGCCGAT
TGCGGCGAAATCGCCTGCCTTGCCGTCTCGCCGCAGGCACAGGACGGCGG
CTACGGCGAACGCCTGCTTGCCCACATTATCGATAAGGCGCGCGGCATAG
GCATAAGCAGGCTGTTCGCACTGTCCACAAATACCGGCGAATGGTTTGCC
GAACGCGGCTTTCAGACGGCATCGGAAGACGAGCTGCCCGAAACGCGGCG
CAAAGACTACCGCAGCAACGGACGAAACCCGCATATTCTGGTGCGTCGCC
TGCACCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy