Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0019 IGR0024 IGR0023 IGR0020 IGR0022 IGR0021 IGR0018 NG0024 NG0022 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0023 argA, - NG0027 NG0026 fhuE, - NG0021 NG0025 NG0024 NG0022 NG0028 pyrE, - NG0029 NG0032 NG0030 NG0023 argA, - NG0027 NG0026 fhuE, - NG0021 NG0025 Type: tandem, Name:  - 3 NG0022 NG0028 pyrE, - NG0029 NG0030 NG0023 argA, - NG0027 NG0026 fhuE, - NG0021 rimI, - NG0031 NG0032 NG0024 rimI, - NG0031 NG0025
* Calculated from Protein Sequence

Gene ID: NG0026

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
prolyl endopeptidase

Gene Start:
24410

Gene Stop:
22398

Gene Length:
2013

Molecular Weight*:
74550

pI*:
5.20

Net Charge*:
-20.69

EC:
3.4.21.26  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.26c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to prolyl peptidases, e.g. residues 2-666 are 30% similar to Y4NA_RHISN (gb|AAB91781).

Residues 1-671 are virtually identical to NMA0579 of N.meningitidis (AL162753).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1505
COG name: Serine proteases of the peptidase family S9A
Functional Class:  E
The phylogenetic pattern of COG1505 is ---k------r---------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00862 (Prolyl oligopeptidase serine protease (S9A) signature) with a combined E-value of 1.4e-40.
    PR00862A    443-461
    PR00862B    470-494
    PR00862C    498-517
    PR00862D    528-548
    PR00862E    584-599
    PR00862F    603-625


ProDom Summary:  Protein Domain Search
Residues 319-513 are 94% similar to a (PROTEASE HYDROLASE SERINE PROTEIN) protein domain (PD003962) which is seen in Q9ZA62_NEIME.

Residues 517-629 are 95% similar to a (PROTEASE HYDROLASE SERINE PROTEIN) protein domain (PD003633) which is seen in Q9ZA62_NEIME.

Residues 2-318 are 94% similar to a (PROTEIN PROBABLE PEPTIDASE Y4NA HYDROLASE SERINE) protein domain (PD042130) which is seen in Q9ZA62_NEIME.



Paralogs:  Local Blast Search


NG0026 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 405 (E-value = 1.3e-07) place NG0026 in the Peptidase_S9_N family which is described as Prolyl oligopeptidase, N-terminal beta-propeller domain (PF02897)
Residues 456 to 535 (E-value = 1.6e-09) place NG0026 in the Peptidase_S9 family which is described as Prolyl oligopeptidase family (PF00326)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
14  
45

PDB Hit:
pdb|1E5T|1E5T-A PROLYL OLIGOPEPTIDASE FROM PORCINE BRAIN, MUTANT146.0 1e-35
pdb|1H2W|1H2W-A PROLYL OLIGOPEPTIDASE FROM PORCINE BRAIN 145.0 2e-35
pdb|1QFM|1QFM-A PROLYL OLIGOPEPTIDASE FROM PORCINE MUSCLE 145.0 2e-35
pdb|1E8M|1E8M-A PROL

Gene Protein Sequence:
MKSYPDPYRHFENLDSAETQNFAAEANAETRARFLNNDKARALSDGILNQ
MQDTRQIPFCQEHRARMYHFHQNAEYPKGVYRMCTAATYRSGYPEWKILF
SVADFDELLGDDVYLGGVSHLVEQPNRALLTLNKSGGDTAYTLEVDLEAG
ELVEGGFHFPAGKNHVSWRDENSVWVCPAWDERQLTESGYPREVWLVERG
KSFEESLPAYQIDKGAMMVNAWRYLDPQGSPIDLIEASDGFYTKTYLQVS
SEGGAKPLNLPNDCDVVGYLAGHLLLTLRKDWHRANQSYPSGALVAVKLN
RGELGAAQLLFAPDETQALESVETTKRFVVASLLENVQGRLKAWRFADSK
WQEAELPHLPSGALEMTDQPWGGDVVYLAASDFTTPLTLFALDLNVMELT
VMRLQPQQFVSDGIEVRQFWAVSSDGERIPYFHVGKNAAPDTPTLVYAYG
GFGIPELPHYLGSVGKYWLEEGNAFVLANIRGGGEFGPRWHQAAQGISKH
KSVDDLLAVVRDLSERGMSSPKHIGLQGGSNGGLITAAAFVREPQSIGAL
VCEVPLTDMIRYPLLSAGSSWTDEYGNPQKYEACKRRLGELSPYHNLSDG
IDYPPALITTSLSDDRVHPAHALKFYAKLRETSPQSWLYSPDGGGHTGNG
TQRESADKLACVLLFLKEFLG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATCCTACCCCGACCCCTACCGCCATTTTGAAAACCTCGATTCCGC
CGAAACGCAAAACTTCGCTGCTGAAGCGAATGCCGAAACGCGCGCGCGTT
TTTTAAACAACGACAAGGCGCGCGCACTTTCAGACGGCATTTTGAATCAA
ATGCAGGACACGCGGCAGATTCCGTTTTGTCAGGAACACCGCGCGCGGAT
GTACCATTTCCATCAGAATGCGGAATATCCGAAGGGCGTGTACCGCATGT
GTACGGCGGCGACCTACCGTTCCGGCTATCCCGAGTGGAAAATCCTGTTT
TCGGTGGCGGATTTCGATGAGTTGCTCGGCGACGATGTGTATTTGGGCGG
CGTGTCGCACTTGGTGGAGCAGCCCAACCGCGCGCTGCTGACTTTGAACA
AATCGGGCGGCGATACGGCGTATACGCTGGAAGTGGATTTGGAAGCAGGG
GAATTGGTAGAGGGCGGTTTTCACTTTCCGGCAGGCAAAAACCATGTGTC
GTGGCGCGATGAAAACAGCGTGTGGGTGTGTCCGGCTTGGGACGAACGCC
AGTTGACCGAATCGGGCTATCCGCGCGAAGTGTGGCTGGTGGAACGCGGC
AAGAGTTTCGAGGAAAGCCTGCCGGCGTACCAAATCGATAAAGGCGCGAT
GATGGTAAACGCGTGGCGTTACCTCGATCCGCAGGGTTCGCCGATTGATT
TGATTGAAGCGTCGGACGGTTTTTACACCAAGACGTATTTGCAGGTGTCG
TCCGAAGGCGGGGCGAAACCGTTGAACCTGCCTAATGATTGCGATGTGGT
CGGCTATCTGGCGGGACATCTTTTGCTGACGCTGCGCAAGGACTGGCACC
GCGCGAACCAAAGCTATCCGAGTGGCGCGTTGGTGGCGGTGAAACTGAAT
CGGGGCGAACTCGGGGCGGCGCAGCTTTTGTTTGCGCCCGATGAAACGCA
GGCATTGGAAAGCGTGGAAACGACCAAGCGTTTTGTGGTGGCAAGCCTGC
TGGAGAATGTACAAGGCCGTCTGAAAGCGTGGCGGTTTGCCGACAGCAAA
TGGCAGGAAGCCGAGTTGCCGCACCTGCCCTCGGGCGCGTTGGAAATGAC
CGACCAACCGTGGGGCGGCGACGTGGTTTATCTTGCCGCCAGCGATTTCA
CCACGCCGCTGACGCTGTTTGCGCTGGATTTGAACGTGATGGAACTGACC
GTCATGCGCCTCCAGCCGCAGCAGTTTGTTTCAGACGGCATCGAAGTGCG
GCAGTTTTGGGCGGTGTCGTCCGACGGCGAACGCATTCCTTATTTCCACG
TCGGCAAAAACGCCGCGCCCGACACGCCGACCTTAGTCTATGCTTACGGA
GGTTTCGGCATTCCTGAATTGCCGCATTATCTGGGCAGCGTCGGCAAATA
TTGGCTGGAAGAGGGCAATGCCTTTGTATTGGCAAACATCCGCGGCGGCG
GAGAATTCGGCCCGCGCTGGCATCAGGCGGCGCAGGGAATCAGCAAACAC
AAAAGCGTTGATGATTTGTTGGCAGTCGTGCGTGATTTGTCCGAACGCGG
CATGAGTTCGCCCAAACACATCGGCTTGCAGGGCGGCAGCAACGGCGGCC
TGATTACCGCCGCCGCCTTCGTGCGCGAACCGCAAAGCATCGGTGCGCTG
GTGTGCGAAGTACCGCTGACCGATATGATCCGTTATCCGCTGCTGTCCGC
CGGTTCAAGTTGGACGGACGAATACGGCAATCCGCAGAAATACGAAGCCT
GCAAACGCCGGCTGGGCGAATTGTCGCCGTATCACAATCTTTCAGACGGC
ATCGATTATCCGCCCGCACTCATTACCACCAGCCTCAGCGACGACCGCGT
CCATCCCGCCCACGCGCTCAAATTCTACGCCAAACTGCGCGAAACCTCGC
CGCAATCTTGGCTCTACTCGCCTGACGGCGGCGGCCATACCGGCAACGGC
ACCCAACGCGAATCCGCCGACAAACTCGCCTGCGTGTTGCTGTTTTTGAA
AGAATTTTTGGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy