Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-1 IGR0013 IGR0019 IGR0020 IGR0016 IGR0015 IGR0010 IGR0014 IGR0011 IGR0018 IGR0017 IGR0012 IGR0009 NG0014 NG0024 NG0010 NG0012 NG0011 NG0022 secG, - NG0016 tpi, - NG0017 NG0023 fhuE, - NG0021 NG0015 NG0020 NG0009 NG0018 pimT, - NG0019 NG0025 NG0014 NG0024 NG0010 NG0012 NG0011 NG0022 secG, - NG0016 tpi, - NG0017 NG0023 fhuE, - NG0021 NG0015 NG0020 NG0009 NG0018 pimT, - NG0019 NG0025 Type: tandem, Name:  - 1 Type: tandem, Name:  - 2 Type: tandem, Name:  - 3 NG0011 NG0022 secG, - NG0016 tpi, - NG0017 NG0023 fhuE, - NG0021 NG0024 NG0010 NG0012 NG0014 NG0015 NG0020 NG0009 NG0018 pimT, - NG0019
* Calculated from Protein Sequence

Gene ID: NG0019

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pimT  

Definition:
protein-L-isoaspartate O-methyltransferase (PimT)

Gene Start:
16000

Gene Stop:
16653

Gene Length:
654

Molecular Weight*:
24068

pI*:
4.60

Net Charge*:
-11.26

EC:
2.1.1.77  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.19

A protein repair enzyme, repairing damaged aspartyl and asparaginyl residues.

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to protein-L-isoaspartate O-methyltransferase sequences, e.g. residues 1-218 are 40% similar to the enzyme in Xylella fastidiosa (gb|AAF85382).

Residues 1-218 are 91% similar to the enzyme in N.meningitidis (AL162753; gb|AAF42219)

COGS Summary:  COGS Search
BeTs to 10 clades of COG0500
COG name: SAM-dependent methyltransferases
Functional Class:  R
The phylogenetic pattern of COG0500 is AMTKYQVCEBRHUJgPOLINX
Number of proteins in this genome belonging to this COG is 10

Blocks Summary:  Blocks Search
***** IPB000682 (Protein-L-isoaspartate(D-aspartate) O-methyltransferase) with a combined E-value of 3.9e-26.
    IPB000682A    22-35
    IPB000682B    46-71
    IPB000682C    75-99
    IPB000682D    126-175
***** IPB001737 (Ribosomal RNA adenine dimethylase) with a combined E-value of 6.2e-08.
    IPB001737A    66-111


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0019 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 206 (E-value = 1.2e-14) place NG0019 in the PCMT family which is described as Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1JG1|1JG1-A CRYSTAL STRUCTURE OF L-ISOASPARTYL (D-ASPARTYL) 74.1 2e-14
pdb|1DL5|1DL5-A PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE 68.3 1e-12
pdb|1I1N|1I1N-A HUMAN PROTEIN L-ISOASPARTATE O-METHYLTRANSFERASE 55.8 6e-09
pdb|1YUB|1YUB SOLUT

Gene Protein Sequence:
MDFEKARFNMVEQQIRPWDVLDFDVLDALEEIPRELFADESLQGLAYADM
ELPLANGHKMLEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAG
RVVSDDIDAERQKRAKAVLDGLSLENIDYVQNNGLTELSAGAPFDAVYVG
GAVTLVPEVLKEQLKDGGRMAVIVGRRPVQRALLITRRGDVFEEKVLFDT
LVAHLDDKDAHPFDSFNF

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTTTGAAAAAGCGCGGTTCAATATGGTCGAACAGCAGATCCGTCC
TTGGGATGTATTGGATTTTGACGTGTTGGACGCTTTGGAGGAGATTCCGC
GCGAGCTTTTCGCGGATGAGTCTTTGCAGGGTTTGGCGTATGCGGATATG
GAGCTGCCGCTTGCCAACGGTCATAAGATGCTCGAGCCGAAAGTCGTGGC
GCGGCTGGCGCAGGGCTTGAAGCTGACGAAAAACGATACGGTTTTGGAAA
TCGGCACGGGTTCGGGCTATGCGACGGCTCTGTTGGCAAAACTGGCTGGC
CGTGTGGTTTCGGACGACATCGATGCCGAACGGCAAAAGCGCGCCAAAGC
GGTTTTGGACGGCTTGTCTTTGGAAAACATCGATTATGTGCAAAATAACG
GGTTGACCGAACTTTCCGCAGGTGCGCCGTTTGATGCGGTTTACGTCGGC
GGCGCGGTAACCCTTGTGCCTGAAGTGTTAAAGGAACAGTTGAAGGACGG
CGGGCGTATGGCGGTTATTGTGGGACGCAGGCCGGTGCAGCGCGCGCTTT
TGATTACGCGCAGGGGCGATGTGTTTGAAGAGAAGGTGCTGTTCGATACT
TTGGTGGCGCATTTGGACGACAAGGATGCCCATCCTTTCGACAGTTTTAA
TTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy