Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-1 IGR0013 IGR0008 IGR0016 IGR0007 IGR0015 IGR0010 IGR0014 IGR0011 IGR0018 IGR0017 IGR0012 IGR0009 NG0014 NG0010 NG0012 NG0011 NG0022 secG, - NG0016 tpi, - NG0017 fhuE, - NG0021 NG0015 NG0020 NG0009 NG0018 pimT, - NG0019 dpnA,DpnII, - NG0008 drg,dpnI,dam, - NG0007 NG0014 NG0010 NG0012 NG0011 NG0022 secG, - NG0016 tpi, - NG0017 fhuE, - NG0021 NG0015 NG0020 NG0009 NG0018 pimT, - NG0019 dpnA,DpnII, - NG0008 drg,dpnI,dam, - NG0007 Type: tandem, Name:  - 1 Type: tandem, Name:  - 2 NG0011 NG0022 secG, - NG0016 tpi, - NG0017 fhuE, - NG0021 NG0010 NG0012 NG0014 NG0015 NG0020 NG0009 NG0018 pimT, - NG0019 dpnA,DpnII, - NG0008 drg,dpnI,dam, - NG0007
* Calculated from Protein Sequence

Gene ID: NG0017

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tpi  

Definition:
triosephosphate isomerase

Gene Start:
15211

Gene Stop:
14441

Gene Length:
771

Molecular Weight*:
28279

pI*:
5.70

Net Charge*:
-4.69

EC:
5.3.1.1  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Fructose and mannose metabolism
Glycerolipid metabolism
Glycolysis / Gluconeogenesis

Comment:
Oklahoma ID: NGO.17c

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to triosephosphate isomerase sequences, e.g. residues 10-251 are 41% similar to the enzyme in C.trachomatis (gb|AAC67921).

Residues 1-257 are virtually identical to the N.meningitidis enzyme (gb|AAF42221).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0149
COG name: Triosephosphate isomerase
Functional Class:  G
The phylogenetic pattern of COG0149 is amtkyqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000652 (Triosephosphate isomerase) with a combined E-value of 3.1e-86.
    IPB000652A    12-22
    IPB000652B    82-122
    IPB000652C    130-156
    IPB000652D    169-193
    IPB000652E    211-242


ProDom Summary:  Protein Domain Search
Residues 10-251 are 40% similar to a (ISOMERASE TRIOSEPHOSPHATE TIM GLYCOLYSIS) protein domain (PD001005) which is seen in O84332_CHLTR.



Paralogs:  Local Blast Search


NG0017 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 255 (E-value = 2.1e-81) place NG0017 in the TIM family which is described as Triosephosphate isomerase (PF00121)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|2BTM|2BTM-A DOES THE HIS12-LYS13 PAIR PLAY A ROLE IN THE 170.0 3e-43
pdb|1TRE|1TRE-A TRIOSEPHOSPHATE ISOMERASE TIM (E.C.5.3.1.1) 168.0 1e-42
pdb|1MO0|1MO0-A STRUCTURAL GENOMICS OF CAENORHABDITIS ELEGANS: 166.0 5e-42
pdb|1BTM|1BTM-A TRIO

Gene Protein Sequence:
MYRQIGMWDQKWVIGNWKMNGRLQNNNALMHRFRILPTAERVLIGLAAPT
VYLLQLHNAMQIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDI
VLIGHSERSLYFGEKNEIQRRKMENVLNVGLIPLLCVGESLEERETGKEH
EVIAHQLSILQGLDTKNIAVAYEPVWAIGTGKVATVEQIADMHAFIYKEI
LSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGASLSYDSFTAI
ISAAQNA

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATCGCCAAATCGGAATGTGGGATCAAAAATGGGTCATCGGCAACTG
GAAAATGAACGGCCGGCTCCAAAACAACAACGCACTGATGCACCGCTTCC
GCATCCTCCCCACCGCCGAACGCGTCCTCATCGGACTCGCCGCCCCGACC
GTTTACCTGCTGCAACTGCACAACGCCATGCAAATCGTCTTAAACAACCG
CATCCTCACCTGCGCCCAAGACGTGAGCCGCTTCCCCGACAACGGCGCGT
ACACCGGCGAAGTGTCCGCCGAAATGCTCGCCGACACCGGCACAGACATC
GTCCTCATCGGACACTCCGAACGCAGCCTTTATTTCGGCGAAAAAAACGA
AATCCAACGCCGCAAAATGGAAAACGTCCTCAACGTCGGACTCATCCCAT
TATTGTGCGTCGGCGAAAGCCTCGAAGAGCGCGAAACCGGCAAAGAACAC
GAAGTCATCGCCCATCAGCTTTCCATCCTGCAAGGGCTGGATACCAAAAA
CATCGCCGTCGCCTACGAACCCGTCTGGGCAATCGGCACAGGCAAAGTCG
CCACCGTCGAACAGATTGCCGATATGCACGCATTCATCTACAAAGAAATC
TTGTCTTTGTGCGGAAGCGATGTTAAAATCCGCGTCCTTTACGGCGGAAG
TGTGAAAGCGGACAACGCGGCCGACATCTTCGCAGTACCTTATGTGGACG
GCGCACTCGTCGGCGGCGCGTCATTGTCGTACGACTCCTTTACCGCCATC
ATCAGTGCCGCACAAAATGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy