Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-1 IGR0013 IGR0008 IGR0007 IGR0010 IGR0014 IGR0006 IGR0011 IGR0005.1 IGR0012 IGR0009 NG0014 NG0010 NG0012 NG0011 NG0005 secG, - NG0016 tpi, - NG0017 NG0015 NG0009 NG0018 dpnA,DpnII, - NG0008 drg,dpnI,dam, - NG0007 leuS, - NG0006 NG0014 NG0010 NG0012 NG0011 NG0005 secG, - NG0016 tpi, - NG0017 NG0015 NG0009 NG0018 dpnA,DpnII, - NG0008 drg,dpnI,dam, - NG0007 leuS, - NG0006 Type: tandem, Name:  - 1 NG0011 NG0005 secG, - NG0016 tpi, - NG0017 NG0010 NG0012 NG0014 NG0015 NG0009 NG0018 dpnA,DpnII, - NG0008 drg,dpnI,dam, - NG0007 leuS, - NG0006
* Calculated from Protein Sequence

Gene ID: NG0008

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:


Gene Name:
dpnA  DpnII  

Definition:
modification methylase (DpnA)

Gene Start:
10394

Gene Stop:
11068

Gene Length:
675

Molecular Weight*:
25769

pI*:
8.50

Net Charge*:
7.49

EC:
2.1.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Porphyrin and chlorophyll metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Secondary Evidence:
de la Campa,A.G., Kale,P., Springhorn,S.S. and Lacks,S.A.
Proteins encoded by the DpnII restriction gene cassette. Two
methylases and an endonuclease.
J. Mol. Biol. 196 (3), 457-469 (1987).
MEDLINE: 88062686


Comment:
Oklahoma ID: NGO.08

See NG0006.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to modification methylases, e.g. residues 3-224 are 58% similar to the enzyme from S.pneumoniae (pir||A24372).

N0008 is weakly related to the N-6 adenine-specific DNA methylase in N.meningitidis (gb|AAF41140).

COGS Summary:  COGS Search
BeTs to 5 clades of COG0863
COG name: Adenine-specific DNA methylase
Functional Class:  L
The phylogenetic pattern of COG0863 is -M-k--v-e--hUJ-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00506 (D21 class N6 adenine-specific DNA methyltransferase signature) with a combined E-value of 6.5e-36.
    PR00506A    13-25
    PR00506B    60-79
    PR00506C    170-192
    PR00506D    193-207
***** IPB001091 (N-4 DNA methylase (N4-MTase)) with a combined E-value of 1e-12.
    IPB001091A    10-22
    IPB001091B    193-203


ProDom Summary:  Protein Domain Search
Residues 171-224 are 59% similar to a (METHYLTRANSFERASE TRANSFERASE MODIFICATION METHYLASE) protein domain (PD000881) which is seen in MT22_STRPN.

Residues 3-170 are 59% similar to a (METHYLTRANSFERASE TRANSFERASE MODIFICATION METHYLASE) protein domain (PD001370) which is seen in ML22_LACLC.



Paralogs:  Local Blast Search


NG0008 is paralogously related to NG0641 (type III restriction/modification system modification methylase) (2e-04).


Pfam Summary:  Pfam Search
Residues 64 to 225 (E-value = 3.5e-54) place NG0008 in the N6_N4_Mtase family which is described as DNA methylase (PF01555)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1G60|1G60-A CRYSTAL STRUCTURE OF METHYLTRANSFERASE MBOII 101.0 1e-22
pdb|1EG2|1EG2-A CRYSTAL STRUCTURE OF RHODOBACTER SPHEROIDES (N6 67.1 3e-12
pdb|1G60|1G60-A CRYSTAL STRUCTURE OF METHYLTRANSFERASE MBOII 287.0 1e-78
pdb|1EG2|1EG2-A CRYS

Gene Protein Sequence:
MRKILEKHPNGCFDMIFADPPYFLSNDGFSCQNGQMVSVNKGNWDKSKGM
AADLEFYEEWLRLCYALLKPNGTIWVCGTFHNIYLIGYLMQTVGYHILNN
ITWEKPNPPPNLSCRFFTHSTETILWAKKNKKAKHTFHYEMMKAQNNGKQ
MKCVWTFAPPNKTEKTFGKHPTQKPLPLLERCILSASNIGDLIFDPFMGS
GTTGVAALKHGRRFCGCELEEDFLN

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGGAAGATATTGGAAAAACATCCAAACGGCTGTTTTGATATGATTTT
CGCAGACCCGCCTTACTTTCTTTCCAATGACGGTTTCAGTTGTCAAAACG
GGCAAATGGTTTCCGTCAATAAGGGCAACTGGGATAAATCCAAAGGAATG
GCGGCAGATTTGGAATTTTACGAAGAATGGCTCCGACTGTGTTACGCCTT
ATTAAAACCAAACGGCACAATTTGGGTTTGCGGCACATTTCATAATATCT
ATTTAATCGGCTACCTGATGCAAACCGTCGGCTACCATATTTTGAACAAT
ATTACTTGGGAAAAACCCAATCCTCCCCCTAATTTGTCCTGCCGTTTCTT
TACCCATTCGACAGAAACAATCTTATGGGCAAAGAAAAATAAAAAAGCCA
AACATACGTTTCATTATGAAATGATGAAAGCACAAAATAATGGCAAACAG
ATGAAATGTGTTTGGACATTCGCACCTCCAAATAAAACCGAAAAAACATT
CGGCAAACATCCGACACAAAAACCACTCCCCTTACTTGAACGCTGCATAC
TATCGGCTTCAAATATCGGAGATTTAATTTTTGACCCTTTTATGGGCAGC
GGCACAACAGGCGTTGCCGCCTTAAAACATGGTCGGAGATTTTGCGGTTG
CGAACTGGAAGAAGATTTTTTGAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy