Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-1 IGR0013 IGR0005 IGR0008 IGR0007 IGR0010 IGR0004 IGR0006 IGR0011 IGR0005.1 IGR0012 IGR0009 NG0014 NG0010 NG0012 NG0011 NG0005 secG, - NG0016 NG0004 tpi, - NG0017 ppk, - NG0003 NG0015 NG0009 dpnA,DpnII, - NG0008 drg,dpnI,dam, - NG0007 leuS, - NG0006 NG0014 NG0010 NG0012 NG0011 NG0005 secG, - NG0016 NG0004 tpi, - NG0017 ppk, - NG0003 NG0015 NG0009 dpnA,DpnII, - NG0008 drg,dpnI,dam, - NG0007 leuS, - NG0006 Type: tandem, Name:  - 1 NG0011 secG, - NG0016 NG0004 tpi, - NG0017 ppk, - NG0003 NG0010 NG0012 NG0005 NG0014 NG0015 NG0009 dpnA,DpnII, - NG0008 drg,dpnI,dam, - NG0007 leuS, - NG0006
* Calculated from Protein Sequence

Gene ID: NG0007

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:


Gene Name:
drg  dpnI  dam  

Definition:
type II restriction endonuclease/DNA adenine methylase

Gene Start:
9365

Gene Stop:
10291

Gene Length:
927

Molecular Weight*:
35913

pI*:
10.20

Net Charge*:
16.36

EC:
2.1.1.72  3.1.21.4  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
de la Campa,A.G., Springhorn,S.S., Kale,P. and Lacks,S.A.
Proteins encoded by the DpnI restriction gene cassette.
Hyperproduction and characterization of the DpnI endonuclease.
J. Biol. Chem. 263 (29), 14696-14702 (1988).
Medline: 89008336

Lyngstadaas,A., Lobner-Olesen,A. and Boye,E.
Characterization of three genes in the dam-containing operon of
Escherichia coli.
Mol. Gen. Genet. 247 (5), 546-554 (1995).
Medline: 95327050


Comment:
Oklahoma ID: NGO.07

See NG0008.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to type II restriction endonucleases, e.g. residues 1-252 are 42% similar to the predicted enzyme from S.pneumoniae (gb|AAA88577.

Residues 1-258 are 95% similar to the predicted enzyme from N.meningitidis (AL162753).

See also similarities to DNA adenine methylase sequences, residues 264-308 are 93% similar to residues 1-46 of DNA adenine methylase, Dam, of Neisseria meningitidis MC5 15678018.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-252 are 43% similar to a (TYPE II RESTRICTION ENZYME) protein domain (PD121415) which is seen in T2D1_STRPN.



Paralogs:  Local Blast Search


NG0007 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 253 (E-value = 1e-212) place NG0007 in the DRP family which is described as Dam-replacing family (PF06044)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNLFFDTQLGKQQNKATHKIRVMSEAWLEKNGYCPCCGSKPMQRFANNKP
VADLFCPNCHEQYELKSKNQKTIGNSVPDGAYRTMLERIRSDTNPNFFFL
AYKKADYSIRQLVLVPKHFITPDMIIPRNKGIKNRPHHIMCSINLAPLPE
SGKIFLIDDSRIIEPETVLKKWQSNLFLRNQNAERKDWLLAVMKCIDQLT
EEFTLSQMYEFENKLSIQFPQNNHIKDKIRQQLQILRDQNMIEFIGRGLY
KKNRQIAPNSQGVLISNHDTEFTRNIYSSAILKTVEVQRNIAAKGSSRKK
VGELLAIYD

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTTATTTTTCGATACCCAATTGGGAAAGCAACAAAATAAAGCAAC
CCACAAAATCCGTGTAATGAGCGAGGCTTGGCTGGAAAAAAACGGCTATT
GCCCCTGTTGCGGAAGCAAGCCGATGCAGAGATTTGCCAATAACAAACCT
GTTGCAGACCTCTTTTGCCCAAATTGCCACGAGCAATATGAATTAAAGAG
TAAAAATCAAAAAACCATAGGCAACAGCGTGCCTGACGGTGCATATCGCA
CTATGTTGGAGCGCATCCGGTCAGATACCAACCCCAACTTTTTCTTTCTT
GCATATAAAAAAGCGGATTACTCCATACGGCAATTGGTGCTTGTACCCAA
ACATTTCATCACGCCGGATATGATTATTCCCAGAAATAAAGGCATTAAAA
ACCGACCGCACCACATTATGTGTTCCATCAATCTCGCCCCTTTGCCTGAA
AGCGGAAAAATATTCTTAATAGACGATTCCCGCATTATCGAACCCGAAAC
CGTTCTGAAAAAATGGCAATCCAACCTGTTTTTACGCAACCAAAATGCGG
AGCGCAAAGACTGGCTTTTGGCTGTTATGAAATGTATCGACCAACTCACC
GAAGAATTCACATTGTCGCAAATGTATGAATTTGAAAACAAACTATCCAT
CCAATTTCCCCAAAACAACCATATCAAAGACAAAATCCGCCAACAGTTGC
AAATTTTGCGTGATCAAAATATGATCGAATTCATTGGTCGCGGACTTTAC
AAAAAAAATCGACAAATTGCACCCAACTCCCAAGGCGTTTTGATTTCAAA
TCATGATACTGAATTTACGAGAAATATTTATTCTTCTGCCATTCTAAAAA
CGGTTGAAGTACAACGCAATATTGCCGCAAAGGGCAGCAGTCGTAAAAAA
GTCGGAGAATTATTGGCAATTTATGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy