Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0005 IGR0008 IGR0007 IGR0010 IGR0003 IGR0004 IGR0006 IGR0005.1 IGR0009 NG0010 NG0012 NG0011 NG0005 NG0004 ppk, - NG0003 NG0009 dpnA,DpnII, - NG0008 drg,dpnI,dam, - NG0007 dnaN, - NG0002 leuS, - NG0006 NG0010 NG0012 NG0011 NG0005 NG0004 ppk, - NG0003 NG0009 dpnA,DpnII, - NG0008 drg,dpnI,dam, - NG0007 dnaN, - NG0002 leuS, - NG0006 NG0011 NG0004 ppk, - NG0003 NG0012 NG0005 NG0010 NG0009 dpnA,DpnII, - NG0008 drg,dpnI,dam, - NG0007 dnaN, - NG0002 leuS, - NG0006
* Calculated from Protein Sequence

Gene ID: NG0006

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
leuS  

Definition:
leucyl-tRNA synthetase

Gene Start:
6500

Gene Stop:
9133

Gene Length:
2634

Molecular Weight*:
98279

pI*:
5.20

Net Charge*:
-19.28

EC:
6.1.1.4  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Valine, leucine and isoleucine biosynthesis

Comment:
Oklahoma ID: NGO.06

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to leucyl-tRNA synthetases, e.g. residues 3-877 are 65% similar to the enzyme from P.aeruginosa (gb|AAG07374).

Residues 1-878 are 88% similar to the enzyme from N.meningitidis (AL162753).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0495
COG name: Leucyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0495 is amtkYQvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001412 (Aminoacyl-transfer RNA synthetases class-I) with a combined E-value of 7.5e-09.
    IPB001412A    44-54
    IPB001412B    633-643


ProDom Summary:  Protein Domain Search
Residues 783-878 are 40% similar to a (SYNTHETASE LEUCYL-TRNA AMINOACYL-TRNA) protein domain (PD118334) which is seen in SYL_ECOLI.

Residues 20-113 are 71% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000389) which is seen in SYL_ECOLI.

Residues 310-430 are 52% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD000939) which is seen in SYL_ECOLI.

Residues 112-173 are 43% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD002670) which is seen in SYV_CHLTR.

Residues 630-758 are 60% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD000476) which is seen in SYL_HAEIN.

Residues 431-579 are 65% similar to a (SYNTHETASE LEUCYL-TRNA AMINOACYL-TRNA) protein domain (PD004139) which is seen in SYL_AQUAE.

Residues 122-226 are 68% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000647) which is seen in SYL_ECOLI.



Paralogs:  Local Blast Search


NG0006 is paralogously related to NG1809 (valyl-tRNA synthetase) (2e-23), NG0069 (isoleucyl-tRNA synthetase) (2e-15) and NG2044 (methionyl-tRNA synthetase (MetG)) (5e-07).


Pfam Summary:  Pfam Search
Residues 15 to 676 (E-value = 1.9e-184) place NG0006 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
704  
731

PDB Hit:
pdb|1H3N|1H3N-A LEUCYL-TRNA SYNTHETASE FROM THERMUS THERMOPHILUS737.0 0.000000
pdb|1FFY|1FFY-A INSIGHTS INTO EDITING FROM AN ILE-TRNA 116.0 2e-26
pdb|1JZQ|1JZQ-A 97.5 9e-21
pdb|1GAX|1GAX-A CRYSTAL STRUCTURE OF THERMUS THERMOPHILUS

Gene Protein Sequence:
MTMQEHYQPAAIEPAAQKKWDDARISNVSEDASKPKYYCLSMFPYPSGKL
HMGHVRNYTIGDVLSRFKLLNGFNVMQPMGWDAFGMPAENAAMKNNVAPA
AWTYDNIEYMKTQLKSLGFAIDWEREVATCKPEYYRWEQWLFTKLFEKGI
VYRKNGTVNWDPVDQTVLANEQVIDGRGWRSGALIEKREIPMYYFKITDY
AEELLNDLDKLEHWPEQVKTMQRNWIGKSRGMTVRFAVSDDSKQGLEGDY
AKFLQVYTTRPDTLMGATYVAVAAEHPLATAAAADKPELQAFIAECKAGS
VAEADMATMEKKGVPTGRYVVNPLNGDKLEVWIANYVLWGYGDGAVMAVP
AHDERDFEFAAKYNLPKKQVIAVGDNAFDANRWQEWYGDKENGVLVNSGD
LDGLDFQTAFDAVAAKLQSQGAGEPKTQYRLRDWGISRQRYWGCPIPIVH
CEKCGDVPVPADQLPVVLPENVVPDGMGSPLAKMPEFYETSCPCCGGAAK
RETDTMDTFMESSWYFFRYMSPKFSDGMVSAESAKYWGAVDQYIGGIEHA
ILHLLYARFFTKLMRDEGLVNVDEPFERLLTQGMVVCETYYRENDKGGKD
WINPADVELTFDDKGRPVSAVLKADGLPVVISGTEKMSKSKNNGVDPQEL
INAYGADTARLFMMFAAPPEQSLEWSDSGVEGAHRFLRRLWRTVYEYLKQ
GGAVKAFAGNQDGLSKELKDLRHKLHSTTAKVSDDYGRRQQFNTAIAAVM
ELLNQYDKTDTGSEQGRAVAQEVLEAAVRLLWPIVPHICETLWSELNGAK
LWEAGWPTVDEAALVKSEIEVMVQVNGKLRGKITVAADASKADLEAAALA
NEGAVKFMEGKPAKKIIVVPGRLVNIVV

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCATGCAAGAACATTACCAGCCCGCCGCCATCGAGCCTGCGGCGCA
GAAAAAATGGGACGACGCCCGTATTTCCAACGTCTCCGAAGACGCTTCCA
AACCCAAATATTATTGCCTTTCGATGTTCCCTTACCCTAGCGGCAAGCTG
CATATGGGGCATGTACGCAACTACACCATCGGCGACGTATTGAGCCGCTT
CAAACTTTTAAACGGCTTCAACGTTATGCAGCCTATGGGTTGGGACGCGT
TCGGCATGCCGGCGGAAAATGCGGCGATGAAAAACAACGTCGCCCCCGCC
GCTTGGACCTACGACAACATCGAATACATGAAAACCCAGCTCAAAAGCCT
GGGTTTTGCGATTGACTGGGAACGCGAAGTCGCCACCTGCAAACCCGAAT
ACTACCGCTGGGAACAATGGCTGTTTACCAAGCTGTTTGAAAAAGGCATC
GTCTATCGCAAAAACGGAACGGTGAACTGGGACCCGGTCGACCAAACCGT
CCTTGCCAACGAGCAAGTCATCGACGGACGCGGCTGGCGTTCGGGCGCGT
TGATCGAAAAACGCGAAATCCCGATGTATTACTTCAAAATTACGGATTAC
GCCGAAGAGCTGCTCAACGATTTGGACAAGCTGGAACACTGGCCGGAACA
AGTCAAAACCATGCAGCGCAACTGGATCGGCAAATCTCGCGGCATGACCG
TGCGCTTCGCCGTTTCAGACGACAGCAAGCAAGGTTTGGAAGGCGATTAC
GCGAAATTCCTGCAAGTTTATACCACCCGCCCCGACACGCTGATGGGTGC
GACTTATGTCGCTGTTGCCGCCGAACATCCGCTGGCAACAGCCGCAGCCG
CCGACAAACCCGAATTGCAGGCATTTATCGCCGAATGCAAAGCCGGTTCG
GTTGCCGAAGCCGATATGGCGACGATGGAGAAAAAAGGCGTGCCGACCGG
CCGCTACGTCGTCAACCCGCTCAACGGCGACAAGCTGGAAGTGTGGATTG
CCAACTATGTCTTGTGGGGCTACGGCGACGGCGCGGTGATGGCTGTTCCG
GCGCACGACGAACGCGATTTCGAGTTTGCCGCCAAATACAATCTGCCGAA
AAAACAAGTCATTGCCGTCGGCGACAACGCATTCGACGCAAACCGATGGC
AAGAATGGTACGGCGACAAAGAAAACGGCGTATTGGTCAACAGCGGCGAC
TTGGACGGCTTGGATTTTCAGACGGCATTTGATGCCGTTGCCGCCAAGCT
GCAAAGCCAAGGTGCGGGCGAACCGAAAACCCAATACCGCCTGCGCGACT
GGGGCATTTCGCGCCAACGCTACTGGGGCTGCCCGATTCCCATCGTCCAT
TGCGAAAAATGCGGAGACGTTCCCGTCCCTGCCGACCAACTGCCCGTCGT
CCTGCCTGAAAACGTCGTACCCGACGGTATGGGTTCGCCGCTGGCAAAAA
TGCCCGAGTTTTACGAAACTTCCTGCCCGTGCTGCGGCGGCGCGGCGAAA
CGCGAAACCGACACCATGGACACCTTCATGGAGTCGAGCTGGTACTTCTT
CCGCTATATGTCGCCCAAGTTTTCAGACGGCATGGTATCGGCAGAATCCG
CGAAATACTGGGGCGCGGTCGACCAATACATCGGCGGCATCGAACACGCG
ATTTTGCACCTCCTGTACGCGCGCTTCTTCACCAAACTGATGCGCGACGA
AGGTTTGGTCAATGTTGACGAACCGTTTGAACGCCTGCTCACGCAAGGTA
TGGTCGTCTGCGAAACCTACTACCGCGAAAACGACAAAGGCGGCAAAGAC
TGGATCAACCCCGCCGATGTCGAGCTGACTTTCGATGACAAAGGCCGCCC
CGTTTCCGCCGTCCTCAAAGCCGACGGACTGCCCGTCGTCATCAGCGGCA
CGGAAAAAATGTCCAAATCCAAAAACAACGGCGTCGATCCGCAAGAACTG
ATTAACGCCTACGGCGCGGACACCGCCCGCCTGTTCATGATGTTCGCCGC
ACCGCCCGAACAGTCCCTCGAATGGAGCGACAGCGGCGTCGAAGGTGCAC
ACCGCTTCCTGCGCCGTCTGTGGCGTACCGTTTACGAATACCTGAAGCAA
GGCGGCGCGGTCAAAGCATTTGCAGGCAACCAAGACGGTTTGTCTAAAGA
ACTCAAAGACCTGCGCCACAAACTGCATTCCACCACCGCCAAAGTCAGCG
ACGACTACGGCCGCCGCCAGCAGTTCAACACCGCCATCGCCGCCGTGATG
GAACTGCTCAACCAATACGACAAAACCGACACCGGCAGCGAACAAGGCCG
CGCCGTCGCCCAAGAAGTATTGGAAGCCGCCGTACGCCTGTTGTGGCCCA
TCGTGCCGCACATCTGCGAAACCCTGTGGAGCGAATTGAACGGCGCGAAA
CTGTGGGAAGCAGGCTGGCCGACAGTCGACGAAGCCGCCCTGGTCAAATC
CGAAATCGAAGTGATGGTTCAAGTCAACGGCAAACTGCGCGGCAAAATCA
CCGTCGCCGCCGACGCCTCCAAAGCCGACCTCGAAGCCGCCGCACTCGCC
AACGAAGGCGCAGTGAAATTCATGGAAGGCAAGCCTGCGAAGAAAATCAT
CGTCGTACCGGGCAGACTGGTGAACATCGTCGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy