Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1797 IGR0005 IGR1795 IGR1796 IGR0002 IGR0003 IGR0004 IGR0005.1 IGR0001 rl34, - NG2182 NG2180 NG0005 rnpA, - NG2181 NG0004 ppk, - NG0003 dnaN, - NG0002 dnaA, - NG0001 leuS, - NG0006 rl34, - NG2182 NG2180 NG0005 rnpA, - NG2181 NG0004 ppk, - NG0003 dnaN, - NG0002 dnaA, - NG0001 leuS, - NG0006 rnpA, - NG2181 NG0004 ppk, - NG0003 NG2180 NG0005 rl34, - NG2182 dnaN, - NG0002 dnaA, - NG0001 leuS, - NG0006
* Calculated from Protein Sequence

Gene ID: NG0003

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ppk  

Definition:
polyphosphate kinase

Gene Start:
5104

Gene Stop:
3050

Gene Length:
2055

Molecular Weight*:
77251

pI*:
8.50

Net Charge*:
9.79

EC:
2.7.4.1  

Functional Class:
Central intermediary metabolism; Phosphorus compounds  

Pathway: pathway table
Oxidative phosphorylation

Secondary Evidence:
Zago,A., Chugani,S. and Chakrabarty,A.M.
Cloning and characterization of polyphosphate kinase and
exopolyphosphatase genes from Pseudomonas aeruginosa 8830
Appl. Environ. Microbiol. 65 (5), 2065-2071 (1999).
MEDLINE: 99240432

Tinsley,C.R. and Gotschlich,E.C.
Cloning and characterization of the meningococcal polyphosphate
kinase gene: production of polyphosphate synthesis mutants.
Infect. Immun. 63 (5), 1624-1630 (1995).
MEDLINE: 95247238



Comment:
Oklahoma ID: NGO.03c

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to polyphosphate kinase sequences, e.g. residues 1-685 are 95% similar to the enzyme from N.meningitidis (gb|AAF42231). Residues 1-683 are 52% similar to the enzyme from P. aeruginosa (gb|AAD29112).

COGS Summary:  COGS Search
BeTs to 4 clades of COG0855
COG name: Polyphosphate kinase
Functional Class:  P
The phylogenetic pattern of COG0855 is -------ce-r-uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003414 (Polyphosphate kinase) with a combined E-value of 3.1e-238.
    IPB003414A    7-55
    IPB003414B    216-240
    IPB003414C    331-369
    IPB003414D    379-429
    IPB003414E    430-476
    IPB003414F    491-537
    IPB003414G    541-595
    IPB003414H    607-627


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0003 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTEQNRILCRELSLLAFNRRVLAQAEDKNVPLLERLRFLCIVSSNLDEFF
EVRMAWLKRENKLHPRRRPDNGKMPSETIADVTEAARSLIRHQYDLFNNV
LQPELARESIHFYRRRNWTGTQKKWIEDYFDRELLPILTPIGLDPSHPFP
RPLNKSLNFAVELDGTDAFGRPSGMAIVQAPRILPRVVPLPSELCGGGHG
FVFLSSILHAHVGKLFPGMNVKGCHQFRLTRDSDLTVDEEDVQNLRAAIQ
NELHDREYGDGVRLEVADTCPAYIRDFLLAQFRLTDAELYQVKGPVNLVR
LNAVPDLVNRPDLKFPPHTPGRLKALGKNSPIFDLVRQSPILLHHPYQSF
DPVVDMIREAAADPAVLAVKMTIYRTGTRSELVPALMKAALADKQVTVVV
ELMARFDEANNVNWAKQLEEAGAHVVYGVFGYKVHAKMALVIRREDGVLK
RYAHLGTGNYHQGTSRIYTDFGLITADEQITADVNTLFMEITGLGKPGRL
NKLYQSPFTLHKMVIGRIARETEHAKAGKPARITAKMNSLIEPTVIEALY
RASAAGVQIDLIVRGMCTLRPGVKGLSENIRVRSIVGRQLEHARVYCFHN
NGADDTFISSADWMGRNFFRRIETATPITAPELKKRVIREGLEMALADNT
HAWLMQPDGGYIRAAPAEGESEADLQNDLWDLLRG

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGAACAAAACCGCATCCTCTGCCGCGAACTGAGCCTGCTGGCATT
CAACCGCCGCGTGTTGGCACAGGCGGAAGACAAAAACGTCCCCCTTTTGG
AACGCCTGCGCTTCCTGTGCATCGTGTCGTCCAATCTTGACGAGTTTTTT
GAAGTCCGCATGGCGTGGCTCAAGCGTGAAAACAAGCTGCACCCCCGGCG
CAGGCCGGACAACGGCAAAATGCCGTCTGAAACCATCGCCGACGTTACCG
AAGCGGCGCGCTCCCTGATACGGCACCAGTACGACCTGTTCAACAACGTC
CTTCAGCCCGAGTTGGCGCGGGAAAGCATCCATTTTTACCGCCGCCGCAA
TTGGACGGGCACGCAGAAAAAATGGATCGAAGACTATTTCGACCGCGAAC
TGCTGCCGATCCTGACCCCCATCGGACTCGACCCTTCCCACCCTTTCCCG
CGCCCGCTGAACAAATCGCTCAACTTCGCCGTAGAACTCGACGGCACGGA
CGCGTTCGGCAGGCCTTCGGGTATGGCGATTGTCCAAGCACCGCGCATCC
TGCCGCGCGTTGTTCCCCTGCCGTCCGAACTGTGTGGCGGCGGACACGGC
TTCGTCTTCCTGTCGTCCATCCTCCACGCCCACGTCGGCAAACTCTTCCC
GGGCATGAACGTCAAAGGCTGCCACCAGTTCCGCCTCACGCGCGACAGCG
ACTTGACCGTTGACGAAGAAGACGTACAAAACCTCCGCGCCGCCATTCAA
AACGAACTGCACGACCGCGAATACGGCGACGGCGTGCGGCTCGAAGTCGC
CGACACCTGTCCCGCCTACATCCGCGACTTTCTGCTCGCGCAATTCAGGC
TGACCGACGCCGAACTCTATCAGGTCAAAGGCCCGGTCAACCTCGTCCGC
CTCAACGCCGTCCCCGACCTAGTCAACCGCCCCGATTTGAAATTTCCGCC
GCACACGCCGGGCCGTCTGAAAGCCTTGGGCAAAAACAGCCCGATCTTCG
ATTTGGTGCGCCAATCGCCCATCCTGCTGCACCACCCCTACCAATCTTTC
GATCCCGTGGTCGATATGATACGCGAAGCCGCCGCCGATCCCGCCGTTCT
TGCCGTCAAAATGACGATTTACCGCACCGGCACGCGCTCCGAACTCGTCC
CCGCCCTGATGAAGGCGGCACTCGCCGACAAACAAGTAACCGTCGTCGTC
GAACTGATGGCGCGTTTTGACGAAGCCAACAACGTCAACTGGGCGAAGCA
GCTCGAAGAGGCGGGAGCGCACGTCGTGTACGGCGTGTTCGGCTACAAAG
TCCACGCCAAAATGGCACTGGTCATCCGCCGCGAAGACGGCGTGCTCAAG
CGTTACGCCCACCTCGGCACGGGCAACTACCACCAAGGCACATCGCGCAT
CTACACCGACTTCGGCCTCATTACCGCCGACGAACAAATCACCGCCGACG
TGAACACATTATTTATGGAAATCACAGGCTTGGGCAAACCCGGGCGGCTG
AACAAACTCTACCAAAGTCCGTTTACCCTGCACAAAATGGTTATCGGCCG
CATCGCTCGCGAAACCGAACACGCAAAAGCCGGCAAACCGGCGCGGATTA
CCGCCAAGATGAATTCGCTCATCGAACCGACTGTCATAGAAGCCCTGTAT
CGGGCAAGCGCGGCAGGCGTGCAAATCGATTTGATTGTGCGCGGTATGTG
TACCTTGCGCCCGGGTGTAAAAGGCTTGTCCGAAAACATCCGCGTCCGCT
CCATCGTCGGCAGGCAGCTCGAACACGCGCGCGTATATTGTTTCCACAAC
AACGGCGCGGACGACACCTTTATTTCCAGCGCGGATTGGATGGGGCGCAA
TTTCTTCCGCCGCATCGAAACCGCCACCCCGATTACCGCGCCCGAACTCA
AAAAACGCGTCATCCGCGAAGGTTTGGAAATGGCACTGGCAGACAATACC
CACGCGTGGCTGATGCAGCCCGACGGCGGCTATATCCGCGCCGCGCCCGC
CGAAGGCGAAAGCGAAGCCGACCTGCAAAACGATTTATGGGATTTGCTCC
GAGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy