Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR346 IGR344 IGR347 IGR345 rl34, - MG466 MG459 hpt, - MG458 devA_2, - MG467 MG464 gltX, - MG462 MG468 mdh,ldh, - MG460 rl34, - MG466 MG459 hpt, - MG458 devA_2, - MG467 MG464 gltX, - MG462 MG468 mdh,ldh, - MG460 Type: inverted, Name:  - 52 hpt, - MG458 devA_2, - MG467 MG464 gltX, - MG462 MG468 rnpA, - MG465 ksgA, - MG463 MG461 ksgA, - MG463 MG461 rl34, - MG466 MG459 rnpA, - MG465 mdh,ldh, - MG460
* Calculated from Protein Sequence

Gene ID: MG463

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ksgA  

Definition:
dimethyladenosine transferase

Gene Start:
568404

Gene Stop:
567628

Gene Length:
777

Molecular Weight*:
29908

pI*:
10.53

Net Charge*:
19.23

EC:
2.1.1.-  

Functional Class:
Other categories; drug and analog sensitivity  

Pathway: pathway table
Amino Acid Metabolism; Histidine metabolism
Amino Acid Metabolism; Tryptophan metabolism
Amino Acid Metabolism; Tyrosine metabolism
Lipid Metabolism; Androgen and estrogen metabolism
Metabolism of Cofactors, Vitamins, and Other Substances; Ubiquinone biosynthesis
Metabolism of Other Amino Acids; Alkaloid biosynthesis I

Comment:
This enzyme dimethylates adjacent adenosine residues in a particular region of 16S rRNA. Inactivation of the enzyme leads to kasgamycin resistance. KSGA enzymes are functionally related to ERM enzymes (EC 2.1.1.48).

See Prosite PDOC00871.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to
dimethyladenosine transferase sequences; for example, residues 1-254 are
60% similar to KSGA_MYCPN, dimethyladenosine transferase of Mycoplasma
pneumoniae,(AE000017). Residues 6-218 are 35% similar to dimethyladenosine
transferase of Borrelia burgdorferi,(AE001160).
Residues 8-215 are 27% similar to TP0337, a predicted dimethyladenosine transferase
from T.pallidum. MG463 is also similar to CT354, a predicted dimethyladenosine transferase
from C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0030 is ehgpcmy.
COG name: Dimethyladenosine transferase (rRNA methylation).
Functional Class: J
BeTs to h,g,c,m,y.


Blocks Summary:  Blocks Search
Residues 21-66, 102-115, 166-187 are members of blocks BL01131A,B,C, concerned with
ribosomal RNA adenine dimethylases.

ProDom Summary:  Protein Domain Search
Residues 12-41,42-71, 72-119, 120-195, 196-215, 220-246 constitute defined domains of
KSGA_MYCGE. Residues 128-233 are 34% similar to a domain of ERMM_STAEP.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 3 to 256 (E-value = 2e-34) place MG463 in the RrnaAD family which is described as Ribosomal RNA adenine dimethylase (PF00398)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
35
non-globular  
36  
123

PDB Hit:
gi|2981999|pdb|1YUB| Solution Structure Of An Rrna Methyltransferase (Ermam) That Confers Macrolide-Lincosamide-Streptogramin Antibiotic Resistance, Nmr, Minimized Average Structure Methyltransferase, Erm, Ermam, Mls Antibiotics, Nmr, Rrna Mol_id: 1; Mol

Gene Protein Sequence:
VNSFFPSRKLGQNFTVNLSVIKRIFAFVKNLNPQAIVEIGVGKGALTNYL
LKLKIPYKGIEIDKRLIEYLLVEKILTEDQLVKGDILKKDFNSFFENLSP
LLCGNIPYSITSPIINKFLESKLRSFVLMTQKEFANRLLAKVNSSDYSAF
GAFCQYYLTITTVFKIDRHAFKPKPKVDSTLILLEKNKSVSYDFKFGLFL
KQCFNQRRKMLINNLKHFFAVDYLLNIIQKQNLKTSIRAQELSPCQLFNL
YQNICNGKN

Gene Nucleotide Sequence:  Sequence Viewer
GTGAATAGTTTTTTTCCTTCACGTAAATTAGGTCAAAATTTTACGGTTAA
TTTAAGCGTCATTAAAAGAATTTTTGCTTTTGTTAAAAATTTAAATCCAC
AAGCAATTGTTGAAATAGGTGTTGGTAAAGGAGCGTTAACAAATTATTTG
TTAAAACTCAAAATACCTTACAAGGGGATAGAAATTGATAAACGCTTAAT
TGAATATCTTCTAGTTGAAAAGATATTAACTGAAGACCAACTAGTTAAAG
GCGATATTCTCAAAAAGGACTTTAATAGTTTTTTTGAAAATTTAAGTCCA
TTATTGTGTGGTAATATCCCATATAGCATTACATCTCCAATAATCAATAA
GTTTTTAGAATCAAAGCTTCGAAGCTTTGTTTTAATGACACAAAAAGAGT
TTGCTAATCGGCTTCTGGCAAAGGTTAATTCTAGTGATTATAGTGCCTTT
GGTGCTTTTTGTCAATACTATTTGACTATTACAACAGTTTTTAAAATTGA
TAGGCATGCTTTTAAACCTAAACCTAAGGTGGATTCAACCTTAATATTAT
TAGAAAAAAATAAATCGGTTAGTTATGACTTTAAGTTTGGTCTGTTTTTA
AAGCAATGTTTCAATCAAAGAAGGAAGATGTTAATTAATAACTTAAAGCA
TTTTTTTGCAGTTGATTATTTACTTAACATTATTCAAAAGCAAAATTTAA
AGACTAGCATTAGAGCGCAAGAGTTGAGTCCTTGTCAACTCTTTAATCTT
TACCAAAACATTTGTAATGGAAAAAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy