Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR346 IGR344 IGR347 IGR345 IGR343 rl34, - MG466 MG459 hpt, - MG458 devA_2, - MG467 MG464 gltX, - MG462 ftsH, - MG457 MG468 mdh,ldh, - MG460 rl34, - MG466 MG459 hpt, - MG458 devA_2, - MG467 MG464 gltX, - MG462 ftsH, - MG457 MG468 mdh,ldh, - MG460 Type: inverted, Name:  - 52 MG459 hpt, - MG458 devA_2, - MG467 MG464 gltX, - MG462 ftsH, - MG457 MG468 rnpA, - MG465 ksgA, - MG463 MG461 ksgA, - MG463 MG461 rl34, - MG466 rnpA, - MG465 mdh,ldh, - MG460
* Calculated from Protein Sequence

Gene ID: MG462

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gltX  

Definition:
glutamyl-tRNA synthetase

Gene Start:
567638

Gene Stop:
566187

Gene Length:
1452

Molecular Weight*:
55930

pI*:
9.85

Net Charge*:
13.02

EC:
6.1.1.17  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Glutamate metabolism
Metabolism of Cofactors, Vitamins, and Other Substances; Porphyrin and chlorophyll metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to glutamyl-tRNA synthetases, e.g.
residues 3-475 are 42% similar to SYE_BACSU. Residues 3-334 are 39% similar to TP0673, a predicted glu-tRNA synthetase in T.pallidum.
MG462 is also similar to CT445, a predicted glu-tRNA synthetase from C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0008 is ehgpcmy.
COG name: Glutamyl- and glutaminyl-tRNA synthetases.
Functional Class: J
BeTs to h,g,c,m,y.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 7-166, 167-256, 257-331, 332-413, 432-474 constitute defined domains
of SYE_MYCGE. Residues 194-242 and 338-414 are 49% similar to SYE_SULSO and
SYEP_DROME respectively.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 3 to 323 (E-value = 1.7e-196) place MG462 in the tRNA-synt_1c family which is described as tRNA synthetases class I (E and Q), catalytic domain (PF00749)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
178  
198

PDB Hit:
gi|1311358|pdb|1GLN| Mol_id: 1; Molecule: Glutamyl-Trna Synthetase; Chain: Null

Gene Protein Sequence:
MEKIRTRYAPSPTGYLHVGGTRTAIFNFLLAKHFNGEFIIRIEDTDTERN
IKEGINSQFDNLRWLGVIADESVYNPGNYGPYLQSQKLAVYKKLAFDLIE
KNLAYRCFCSKEKLESDRKQAINNHKTPKYLGHCRNLHSKKITNHLEKND
PFTIRLKINNEAEYSWNDLVRGQITIPGSALTDIVILKANGVATYNFAVV
IDDYDMEITDVLRGAEHISNTAYQLAIYQALGFKRIPRFGHLSVIVDESG
KKLSKRDEKTTQFIEQFKQQGYLPEALLNFLALLGWHPQYNQEFFNLKQL
IENFSLSRVVSAPAFFDIKKLQWINANYIKQLTDNAYFNFIDNYLDVKVD
YLKDKNREISLLFKNQITHGVQINELIRESFATKIGVENLAKKSHILFKN
IKLFLEQLAKSLQGLEEWKAEQIKTTINKVGAVFNLKGKQLFMPIRLIFT
NKEHGPDLAHIIEIFDKESAINLIKQFINATNLF

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAAATTAGAACACGTTATGCACCATCCCCAACAGGATATCTGCA
TGTTGGTGGTACAAGAACAGCAATCTTTAACTTTTTACTAGCCAAGCACT
TTAATGGTGAGTTTATTATCAGGATAGAAGATACTGATACTGAAAGAAAC
ATAAAAGAAGGAATTAATTCACAATTTGATAACTTGCGTTGGCTTGGAGT
CATTGCAGATGAATCGGTTTATAACCCTGGCAATTATGGTCCATATCTGC
AATCACAAAAACTAGCAGTTTATAAAAAACTAGCATTTGATTTAATTGAA
AAAAATCTGGCATATCGTTGCTTCTGTAGCAAAGAAAAATTAGAGTCAGA
TAGAAAACAAGCCATTAATAACCACAAAACCCCTAAATACTTAGGTCATT
GTCGTAATTTACATTCCAAGAAAATTACTAATCACTTAGAAAAAAATGAT
CCTTTTACTATCCGCTTAAAAATAAACAATGAAGCTGAATATAGTTGAAA
TGATCTGGTTAGGGGACAAATTACTATTCCCGGCAGTGCGTTAACAGATA
TAGTTATTCTTAAAGCTAATGGTGTTGCTACTTATAACTTTGCAGTTGTT
ATTGATGATTATGATATGGAAATTACTGATGTTTTAAGGGGAGCTGAGCA
CATCTCTAACACTGCATACCAACTTGCTATATATCAAGCATTAGGTTTTA
AAAGAATTCCCCGCTTTGGTCATCTTTCAGTTATTGTTGATGAAAGTGGC
AAAAAACTTTCTAAACGTGATGAGAAAACTACTCAGTTTATTGAGCAGTT
TAAACAACAAGGCTATCTACCTGAAGCATTATTAAATTTCTTAGCACTCT
TAGGTTGACATCCACAGTACAACCAGGAGTTTTTTAATTTGAAACAGTTA
ATTGAAAACTTTAGTTTAAGTAGAGTTGTTAGTGCTCCTGCTTTTTTTGA
TATTAAAAAGCTGCAATGAATCAATGCTAATTACATTAAACAATTAACTG
ATAATGCTTATTTCAATTTCATTGATAATTACTTGGATGTTAAGGTTGAT
TATTTAAAAGATAAAAACAGGGAAATAAGTTTACTTTTTAAAAATCAAAT
AACCCATGGTGTTCAAATAAACGAATTGATAAGAGAATCTTTTGCCACTA
AAATAGGTGTTGAAAACTTAGCTAAGAAAAGTCATATTTTGTTTAAAAAC
ATCAAACTTTTTTTAGAACAGCTTGCCAAATCTTTACAAGGGTTGGAAGA
ATGAAAAGCTGAGCAAATTAAAACAACTATTAACAAAGTAGGAGCAGTGT
TTAACTTAAAAGGTAAACAACTTTTTATGCCAATAAGGTTAATTTTTACA
AATAAGGAGCATGGACCTGATTTAGCACATATTATTGAAATTTTTGATAA
AGAAAGTGCAATAAACTTAATTAAGCAATTTATTAATGCAACAAACCTTT
TT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy