Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR346 IGR344 IGR345 IGR343 IGR342 MG459 hpt, - MG458 MG456 MG464 gltX, - MG462 ftsH, - MG457 mdh,ldh, - MG460 MG459 hpt, - MG458 MG456 MG464 gltX, - MG462 ftsH, - MG457 mdh,ldh, - MG460 MG459 hpt, - MG458 MG456 MG464 gltX, - MG462 ftsH, - MG457 ksgA, - MG463 MG461 ksgA, - MG463 MG461 mdh,ldh, - MG460
* Calculated from Protein Sequence

Gene ID: MG460

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mdh  ldh  

Definition:
lactate/malate dehydrogenase

Gene Start:
563991

Gene Stop:
564926

Gene Length:
936

Molecular Weight*:
33953

pI*:
9.34

Net Charge*:
4.40

EC:
1.1.1.27  

Functional Class:
Energy metabolism; Anaerobic  

Pathway: pathway table
Amino Acid Metabolism; Cysteine metabolism
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Carbohydrate Metabolism; Propanoate metabolism
Carbohydrate Metabolism; Pyruvate metabolism

Comment:
See Cordwell et al, 1997 GENE 195:113-120
Both lactate and malate dehydrogenase activities have been detected in M. genitalium. This ORF appears to encode a protein with enzymatic activity of both these functions.

See Prosite PDOC00062 and PDOC00066.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to L-lactate dehydrogenase sequences, e.g.
residues 1-312 are 80% similar to LDH_MYCPN. Residues 1-308 are 49%
similar to LDH_MYCHY. Residues 1-307 are 36% similar to the predicted L-lactate dehydrogenase
from B.burgdorferi (AE001121). No similarities to T.pallidum or C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0039 is ehgpcmy.
COG name: Malate/lactate dehydrogenases.
Functional Class: C
BeTs to h,g,c,m,y.


Blocks Summary:  Blocks Search
Residues 5-40, 65-112, 66-113, 117-163, 164-195, 204-255, 266-310 are
members of blocks BL00064A-F (L-lactate dehydrogenases). Residues
74-101, 73-100, 117-164, 268-290 are matched to blocks BL00068B,C,E,
concerned with malate dehydrogenases, e.g. MDH_CHLAU. Residues
5-20 and 226-244 are matched to blocks PR00370A,D, concerned with
flavin-containing monooxygenase signatures, e.g. FMO1_HUMAN.

ProDom Summary:  Protein Domain Search
Residues 5-52, 53-173, 197-296 constitute defined domains of LDH_MYCGE.
Residues 269-311 are 43% similar to MDH_HAEIN.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 4 to 145 (E-value = 1.8e-50) place MG460 in the Ldh_1_N family which is described as lactate/malate dehydrogenase, NAD binding domain (PF00056)
Residues 147 to 312 (E-value = 6.2e-56) place MG460 in the Ldh_1_C family which is described as lactate/malate dehydrogenase, alpha/beta C-terminal domain (PF02866)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
84  
111
coil-coil  
281  
312

PDB Hit:
gi|230128|pdb|1LLC| L-Lactate Dehydrogenase (E.C.1.1.1.27) Complex With Fructose-1,6-Bisphosphate (FBP) And Co2+

Gene Protein Sequence:
MKGPKIAIVGSGAVGTSFLYAAMTRALGSEYMIIDINEKAKVGNVFDLQD
ASSSCPNFGKVVAGEYSQLKDYDFIFISAGRPQKQGGETRLQLLEGNVEI
MKSIAKEIKKSGFNGVTLIASNPVDIMSYTYLKVTGFEPNKVIGSGTLLD
SARLRYAIATKYQMSSKDVQAYVIGEHGDSSVSIISSAKIAGLSLKHFSK
ASDIEKEFGEIDQFIRRRAYEIIERKGATFYGIGEASADVAEQILKDTKE
VRVVAPLLTGQYGAKDMMFGTPCVLSRKGIEKILEIELSNTEKVALENSI
KVLKDNIKLAKL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGGACCTAAAATTGCAATAGTAGGATCAGGTGCTGTTGGTACTAG
TTTTCTATATGCTGCAATGACTCGTGCACTTGGTAGTGAATACATGATTA
TAGATATCAATGAAAAAGCTAAAGTTGGTAATGTATTTGATCTTCAAGAT
GCTTCCTCATCATGCCCAAATTTTGGCAAAGTAGTTGCTGGAGAATACAG
TCAATTAAAAGATTATGATTTTATTTTCATTAGTGCAGGAAGACCTCAAA
AACAAGGTGGGGAAACTAGGTTGCAGCTACTTGAAGGCAATGTAGAAATT
ATGAAAAGCATTGCCAAAGAAATCAAAAAATCTGGTTTTAATGGAGTTAC
ATTAATCGCTTCAAACCCAGTTGATATCATGTCATATACATATCTTAAAG
TTACTGGATTTGAACCTAATAAAGTAATTGGCTCTGGTACTTTACTTGAT
AGTGCAAGATTAAGATATGCAATTGCAACTAAGTACCAAATGAGTTCAAA
GGATGTACAAGCATATGTTATTGGTGAACATGGTGATAGTTCAGTAAGTA
TTATTTCATCAGCTAAAATTGCAGGACTATCACTAAAACATTTTTCTAAA
GCTAGTGATATTGAAAAAGAATTTGGTGAAATTGACCAATTTATCAGACG
CAGAGCTTATGAAATTATTGAACGCAAAGGTGCTACTTTCTATGGAATTG
GTGAAGCTAGTGCTGATGTAGCTGAACAAATTTTGAAAGATACTAAAGAA
GTTAGAGTAGTGGCTCCTTTACTTACTGGTCAGTATGGAGCGAAGGATAT
GATGTTTGGAACTCCTTGTGTACTTTCAAGAAAAGGTATTGAAAAGATCT
TGGAAATAGAACTTTCAAATACTGAAAAAGTTGCGCTTGAAAATTCAATT
AAAGTTTTGAAAGACAACATTAAACTAGCAAAGCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy