Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR346 IGR344 IGR345 IGR343 IGR342 MG459 hpt, - MG458 MG456 gltX, - MG462 ftsH, - MG457 mdh,ldh, - MG460 tyrS, - MG455 MG459 hpt, - MG458 MG456 gltX, - MG462 ftsH, - MG457 mdh,ldh, - MG460 tyrS, - MG455 MG459 hpt, - MG458 MG456 gltX, - MG462 ftsH, - MG457 ksgA, - MG463 MG461 ksgA, - MG463 MG461 mdh,ldh, - MG460 tyrS, - MG455
* Calculated from Protein Sequence

Gene ID: MG458

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hpt  

Definition:
hypoxanthine-guanine phosphoribosyltransferase

Gene Start:
563307

Gene Stop:
562783

Gene Length:
525

Molecular Weight*:
19743

pI*:
8.18

Net Charge*:
2.76

EC:
2.4.2.8  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism

Comment:
This enzyme forms hypoxanthine or guanine as part of the purine salvage pathway.

Taken from Prosite PDOC00096: Phosphoribosyltransferases (PRT) are enzymes that catalyze the synthesis of beta-n-5'-monophosphates from phosphoribosylpyrophosphate (PRPP) and an enzyme specific amine. A number of PRT's are involved in the biosynthesis of purine, pyrimidine, and pyridine nucleotides, or in the salvage of purines and pyrimidines.

The reaction catalyzed is as follows:
IMP + Diphosphate <=> Hypoxanthine + 5-Phospho-Alpha-D-Ribose 1-Diphosphate.

Reference: Mol. Gen. Genet. 235 (2-3), 359-364 (1992).

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to hypoxanthine-guanine phosphoribosyltransferase sequences, e.g. residues
1-174 are 72% similar to HPRT_MYCPN. Residues 3-173 are 38% similar to HPRT_LACLA. No similarities
to T.pallidum or C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0634 is ehgpc--.
COG name: Hypoxanthine-guanine phosphoribosyltransferase.
Functional Class: F
BeTs to h,g.


Blocks Summary:  Blocks Search
Residues 89-104 and 102-117 are members of block BL00103B
(purine/pyrimidine phosphoribosyl transferases). Residues
81-126 and 100-145 are matched to blocks BL00114B,D, concerned with
phosphoribosyl pyrophosphate synthetases, e.g. KPR2_YEAST.

ProDom Summary:  Protein Domain Search
Residues 8-33 and 34-168 constitute defined domains of HPRT_MYCGE. Residues 88-138
are 28% similar to PUR1_ECOLI.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 2 to 146 (E-value = 1.3e-30) place MG458 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
34  
54
non-globular  
78  
175

PDB Hit:
gi|1827785|pdb|1HGX|A Chain A, Hypoxanthine-Guanine-Xanthine Phosphoribosyltransferase (Hgxprtase) Transferase, Glycosyltransferase, Purine Salvage Mol_id: 1; Molecule: Hypoxanthine-Guanine-Xanthine Phosphoribosyltransferase; Chain: A, B; Synonym: Hgxprta

Gene Protein Sequence:
MGIKSIVINEQQIEEGCQKAVNWCNAKFNNKKVIVLGILKGCIPFLGKVI
SKFSFDLQLDFMAVASYHGSHVQKQPPKIVLDMSHDPKDKDILLIEDIVD
SGRSIKLVIDLLKTRHAKSITLISLIEKIKPKAFDINIDFSCFKVKDNFL
VGFGLDYDGFYRNLPYVGVFEPDNP

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTATTAAATCTATTGTTATTAATGAACAACAGATAGAAGAAGGCTG
TCAAAAAGCAGTTAATTGGTGCAATGCTAAATTTAATAATAAAAAGGTAA
TTGTTCTTGGCATTCTAAAAGGTTGCATCCCTTTCCTTGGCAAAGTGATA
AGTAAATTTAGTTTTGACCTCCAACTAGATTTTATGGCAGTTGCTTCTTA
TCATGGTTCACATGTACAAAAACAACCACCTAAGATTGTGCTTGATATGT
CCCATGACCCTAAAGATAAAGACATCCTTTTAATAGAAGATATTGTTGAT
AGTGGTAGATCTATTAAATTAGTTATTGATCTTCTAAAAACAAGGCATGC
TAAATCAATAACTTTAATTAGCTTAATTGAAAAGATTAAACCCAAAGCCT
TTGATATTAATATTGATTTTTCTTGTTTTAAAGTAAAAGATAATTTTTTG
GTTGGCTTTGGTCTTGACTATGATGGTTTTTATCGTAACCTACCTTATGT
TGGTGTGTTTGAACCAGACAATCCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy