Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR346 IGR344 IGR345 IGR343 IGR342 MG454 MG459 hpt, - MG458 MG456 gltX, - MG462 ftsH, - MG457 gtaB, - MG453 mdh,ldh, - MG460 tyrS, - MG455 MG454 MG459 hpt, - MG458 MG456 gltX, - MG462 ftsH, - MG457 gtaB, - MG453 mdh,ldh, - MG460 tyrS, - MG455 MG454 MG459 hpt, - MG458 MG456 ftsH, - MG457 MG461 MG461 gltX, - MG462 gtaB, - MG453 mdh,ldh, - MG460 tyrS, - MG455
* Calculated from Protein Sequence

Gene ID: MG457

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ftsH  

Definition:
FTSH cell division protein

Gene Start:
562602

Gene Stop:
560497

Gene Length:
2106

Molecular Weight*:
76722

pI*:
10.01

Net Charge*:
13.18

EC:
3.4.24.-  

Functional Class:
Cellular processes; Cell division  

Pathway: pathway table
Miscellaneous enzymes

Comment:
FTSH is an integral membrane protein that acts as an ATP-dependent metallopeptidase.

See Prosite PDOC00572 for an extended definition on AAA-protein
family signatures.

Reference:Proc Natl Acad Sci U S A. 1993 Nov 15;90(22):10861-5.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to FTSH cell division proteins, e.g.
residues 3-702 are 74% similar to FTSH_MYCPN. Residues 180-664 are 47% similar to TP0765, a predicted cell division protein from T.pallidum.
Residues 180-701 are 45% similar to CT841, an FTSH/AAA ATPase-protease.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0465 is ehgpc-y.
COG name: ATP-dependent Zn proteases.
Functional Class: O
BeTs to h,g,c,y.


Blocks Summary:  Blocks Search
Residues 74-119, 230-245, 264-285, 303-339, 357-402, 434-454, 443-488
are members of blocks BL00674A-E (AAA-protein family proteases).

ProDom Summary:  Protein Domain Search
Residues 1-219, 302-334, 375-451, 480-514, 515-664 constitute defined
domains of FTSH_MYCGE or FTSH_MYCPN. Residues 236-559 are 26%
similar to LON1_BACSU.

Paralogs:  Local Blast Search
MG457 is very weakly similar to MG359, a proposed helicase: residues
245-433 are 25% similar to MG359.

Pfam Summary:  Pfam Search
Residues 81 to 240 (E-value = 4e-35) place MG457 in the FtsH_ext family which is described as FtsH Extracellular (PF06480)
Residues 266 to 453 (E-value = 4.7e-91) place MG457 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 459 to 666 (E-value = 5.8e-124) place MG457 in the Peptidase_M41 family which is described as Peptidase family M41 (PF01434)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
27  
49
non-globular  
72  
167
transmembrane  
181  
198
coil-coil  
347  
385
non-globular  
609  
702

PDB Hit:


Gene Protein Sequence:
MKKRNKGLVEQTTTEKNNFSRKTAWKVFWWVIILAVVIGVLAYIFSPRAA
TAVVESWKLNGGSNSTLTAKVSGFSNELTFKQINGSTYVTDTILQVSITF
DGLNSPLTVTAHKTVNSNGNVIFNIANLSINQSNGQITVNSNGTMMNGGS
SNNTKSIAGFETLGTFIAPDTRARDVLNGLFGLLPIIIFVVFFLLFWRSA
RGISAGGREEDNIFSIGKTQAKLAKSTVKFTNIAGLQEEKHELLEIVDYL
KNPLKYAQMGARSPRGVILYGPPGTGKTLLAKAVAGEAGVPFFQSTGSGF
EDMLVGVGAKRVRDLFNKAKKAAPCIIFIDEIDSVGSKRGRVELSSYSVV
EQTLNQLLAEMDGFTSRTGVVVMAATNRLDVLDDALLRPGRFDRHIQINL
PDIKEREGILKVHAENKNLSSKISLLDVAKRTPGFSGAQLENVINEATLL
AVRDNRTTININDIDEAIDRVIAGPAKKSRVISDEDRKLVAYHEAGHALV
GLHVHSNDEVQKITIIPRGQAGGYTLSTPKSGDLNLKRKSDLLAMIATAM
GGRAAEEEIYGNLEITTGASSDFYKATNIARAMVTQLGMSKLGQVQYVPS
QGTLPSNVKLYSEQTAKDIDNEINFIIEEQYKKAKTIIKSNRKELELLVE
ALLIAETILKSDIDFIHKNTKLPPEILLQKQEQQAKQKLNKSEVKPESET
NS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAAAGAAATAAGGGTTTAGTAGAACAAACAACTACTGAAAAAAA
TAATTTTTCACGTAAAACTGCTTGAAAAGTCTTTTGATGAGTCATCATTT
TAGCTGTTGTTATTGGTGTTTTAGCTTATATTTTCAGTCCAAGAGCTGCT
ACTGCAGTAGTTGAAAGCTGAAAATTAAATGGAGGTAGTAACAGCACTTT
AACAGCAAAAGTAAGCGGTTTTAGTAATGAACTGACATTTAAACAAATAA
ATGGTTCAACTTATGTTACTGATACCATTCTCCAAGTTTCCATTACCTTT
GATGGTTTAAATAGTCCATTAACTGTTACTGCTCACAAAACTGTTAATAG
TAATGGCAATGTTATCTTTAATATTGCTAACTTATCAATTAACCAAAGTA
ATGGTCAGATTACCGTTAATAGTAATGGAACCATGATGAATGGTGGTTCT
AGTAATAACACAAAGAGTATTGCAGGTTTTGAAACCCTTGGTACTTTCAT
TGCTCCTGATACTAGAGCTAGAGATGTATTAAATGGTTTGTTTGGCTTGC
TACCAATTATTATCTTTGTAGTTTTCTTTTTACTCTTTTGAAGAAGTGCT
AGGGGTATATCTGCAGGGGGCAGAGAAGAAGATAATATTTTTTCTATTGG
CAAAACCCAAGCTAAGTTGGCTAAGTCAACTGTGAAATTTACCAATATTG
CTGGACTTCAAGAGGAAAAGCATGAGTTGCTTGAGATAGTTGATTATTTA
AAAAATCCATTGAAATATGCCCAGATGGGAGCAAGATCCCCACGTGGGGT
AATTTTATACGGTCCACCTGGGACAGGTAAAACATTATTAGCTAAAGCAG
TAGCTGGTGAAGCTGGTGTTCCTTTCTTTCAATCAACGGGTTCTGGATTT
GAAGATATGCTTGTTGGTGTTGGTGCTAAACGAGTTAGAGATCTTTTCAA
TAAAGCTAAAAAGGCTGCTCCTTGTATTATTTTTATTGATGAAATTGATT
CAGTTGGTTCTAAACGGGGTAGAGTTGAACTCTCTTCTTATTCTGTTGTT
GAGCAAACCTTAAACCAATTGTTAGCTGAAATGGATGGATTTACAAGCAG
AACAGGTGTTGTTGTAATGGCAGCTACAAATAGGTTAGATGTATTAGATG
ATGCATTATTAAGACCTGGAAGATTTGATAGACATATTCAAATCAATCTC
CCTGATATTAAAGAAAGGGAAGGGATTTTAAAAGTTCATGCTGAAAATAA
AAATCTCTCTTCTAAGATAAGTCTTTTAGATGTTGCTAAGAGAACTCCTG
GGTTTTCAGGTGCTCAATTAGAAAATGTTATCAATGAAGCTACATTGTTA
GCAGTTAGAGACAACCGTACCACAATTAACATTAATGACATTGATGAAGC
AATTGATAGAGTAATAGCTGGTCCTGCTAAAAAGTCACGTGTAATTAGTG
ATGAAGATAGAAAACTAGTTGCTTATCATGAGGCTGGTCATGCCTTGGTT
GGTTTACATGTCCACAGTAATGATGAAGTACAAAAGATTACCATTATTCC
TCGTGGTCAAGCAGGGGGTTACACACTTTCAACACCTAAGAGTGGTGATC
TTAACCTAAAAAGAAAATCTGATTTACTTGCAATGATAGCAACTGCTATG
GGCGGTAGAGCTGCTGAAGAGGAAATCTATGGTAATTTAGAAATTACTAC
TGGCGCTTCTAGCGATTTTTATAAAGCAACTAATATTGCAAGAGCAATGG
TAACCCAGCTTGGGATGTCTAAATTAGGTCAAGTGCAATATGTACCAAGT
CAAGGGACACTCCCTTCTAATGTAAAACTTTATTCAGAACAAACTGCTAA
AGATATTGACAATGAGATTAATTTCATTATTGAAGAACAGTATAAGAAAG
CAAAAACAATCATTAAGAGTAACCGTAAGGAACTAGAATTGCTTGTAGAA
GCACTTTTAATTGCTGAAACTATTTTGAAAAGTGATATTGACTTCATCCA
TAAAAACACTAAACTACCACCAGAAATCTTATTGCAAAAGCAAGAACAAC
AAGCAAAGCAAAAACTAAATAAATCTGAAGTAAAACCAGAAAGTGAAACA
AACAGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy