Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR344 IGR341 IGR340 IGR343 IGR339 IGR342 MG454 MG459 hpt, - MG458 MG450 MG456 tuf, - MG451 ftsH, - MG457 gtaB, - MG453 tyrS, - MG455 MG454 MG459 hpt, - MG458 MG450 MG456 tuf, - MG451 ftsH, - MG457 gtaB, - MG453 tyrS, - MG455 MG454 hpt, - MG458 MG450 MG456 tuf, - MG451 ftsH, - MG457 MG459 gtaB, - MG453 tyrS, - MG455 MG452 MG452
* Calculated from Protein Sequence

Gene ID: MG455

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tyrS  

Definition:
tyrosyl-tRNA synthetase

Gene Start:
557724

Gene Stop:
558944

Gene Length:
1221

Molecular Weight*:
46819

pI*:
10.18

Net Charge*:
15.38

EC:
6.1.1.1  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
From PDOC00161 (Prosite): Aminoacyl-tRNA synthetases (EC 6.1.1.-) are a group of enzymes which activate amino acids and transfer them to specific tRNA molecules as the first step in protein biosynthesis. In prokaryotes there are at least 20 aminoacyl-tRNA synthetases, one for each different amino acid.

Reference: FEBS Lett. 1982 Dec 27;150(2):419-23.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to tyrosyl-tRNA synthetase sequences, e.g. residues
12-405 are 58% similar to SYY_MYCPN. Residues 13-402 are 35% similar to SYY1_BACSU.
Residues 47-384 are 35% similar to CT062, a predicted tyrosyl-tRNA synthetase from
C.trachomatis. MG455 is also highly similar to TP0834, a tyr-tRNA synthetase from T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0162 is ehgpcmy.
COG name: Tyrosyl-tRNA synthetase.
Functional Class: J
BeTs to e,g,c,m,y.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-21, 48-110, 129-165, 175-236, 237-266, 267-301, 302-328, 344-376 constitute
defined domains of SYY_MYCGE.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 39 to 328 (E-value = 2.7e-112) place MG455 in the tRNA-synt_1b family which is described as tRNA synthetases class I (W and Y) (PF00579)
Residues 342 to 389 (E-value = 1.9e-09) place MG455 in the S4 family which is described as S4 domain (PF01479)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
41
coil-coil  
295  
322

PDB Hit:
gi|230779|pdb|2TS1| Tyrosyl-Transfer RNA Synthetase (E.C.6.1.1.1)

Gene Protein Sequence:
MLINIDNILVKMLNNILQFLKERELYSQANFETELDNHLKEKKNNFYVGF
DPTANSLHIGNYVLIHIAKLLKDMGHTPHIVLGSATALIGDPTGRIELRK
ILEEKEIVKNTKTIKKQIKQFLGDVIIHENKVWLEKLNYIEVIRELGAFF
SVNKMLSTDAFSARWEKGLTLMELNYMILQAYDFYYLHKNHNVTLQIGGS
DQWANILAGANLIKRKNNASVFGLTANLLVKANGEKMGKTSSGALWLDEN
KTSVFDFYQYWINLDDQSLKKTFLMLTMLDKKVIDELCNLKGPKIKQTKQ
MLAFLITELIHGTKKAKEAQQRSELIFSNQPDLDIKLVKTSTNLIDYLVE
TKFIKSKSEARRLISQKGLTINNKHVLDLNQIIEWKEELQIIRKGKKSFL
TIKTVNS

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAATTAATATAGATAATATTTTAGTAAAAATGTTAAATAACATATT
GCAATTTCTCAAAGAAAGAGAACTTTATTCACAAGCTAATTTTGAAACAG
AACTAGATAACCATTTAAAAGAGAAAAAAAATAACTTTTATGTTGGTTTT
GATCCAACTGCTAATTCTTTACATATTGGCAATTATGTTTTAATTCACAT
TGCAAAATTATTAAAAGACATGGGGCATACTCCGCACATAGTTCTAGGGA
GTGCAACTGCTTTAATTGGTGATCCTACTGGCAGAATTGAATTAAGGAAA
ATTTTAGAAGAAAAAGAAATTGTAAAAAACACCAAAACAATTAAAAAACA
AATCAAACAGTTTTTAGGTGATGTAATTATTCATGAAAACAAAGTTTGAT
TAGAAAAACTTAATTACATTGAAGTTATCCGTGAATTAGGTGCTTTTTTT
TCAGTTAACAAGATGTTAAGCACAGACGCATTTAGTGCTAGGTGAGAAAA
AGGACTAACTCTAATGGAATTAAACTATATGATCTTACAAGCATATGACT
TTTATTATCTACATAAAAACCATAATGTCACTTTACAAATAGGTGGAAGT
GATCAGTGGGCTAATATTTTGGCTGGTGCTAACTTAATTAAAAGAAAAAA
TAATGCTAGTGTTTTTGGATTAACTGCTAATTTATTAGTTAAAGCTAACG
GAGAAAAAATGGGTAAAACTAGTAGCGGAGCATTATGACTTGATGAAAAT
AAAACTAGTGTTTTTGATTTTTATCAATACTGGATTAACCTTGATGATCA
AAGCTTAAAAAAGACTTTTTTAATGCTAACAATGCTTGATAAAAAAGTAA
TAGATGAATTGTGTAATTTAAAAGGCCCAAAAATTAAACAAACCAAGCAA
ATGCTAGCCTTTTTAATTACTGAATTAATCCATGGCACTAAAAAAGCAAA
AGAAGCACAACAACGATCTGAACTAATATTTAGTAATCAACCAGATCTTG
ATATTAAGTTAGTAAAAACAAGCACTAATCTAATTGATTATTTAGTTGAA
ACTAAATTTATTAAAAGTAAATCAGAAGCAAGAAGATTAATTAGTCAAAA
AGGTTTGACAATTAACAATAAACACGTTTTAGACTTAAACCAAATAATTG
AATGAAAAGAAGAGTTACAAATTATTAGAAAAGGTAAAAAAAGTTTTTTA
ACAATTAAAACTGTTAATTCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy