Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR338 IGR341 IGR340 IGR339 IGR342 MG448 MG454 MG450 MG456 tuf, - MG451 MG447 ftsH, - MG457 gtaB, - MG453 tyrS, - MG455 MG448 MG454 MG450 MG456 tuf, - MG451 MG447 ftsH, - MG457 gtaB, - MG453 tyrS, - MG455 MG454 MG450 MG456 tuf, - MG451 MG447 ftsH, - MG457 MG449 MG448 MG449 gtaB, - MG453 tyrS, - MG455 MG452 MG452
* Calculated from Protein Sequence

Gene ID: MG453

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gtaB  

Definition:
UTP--glucose-1-phosphate uridyltransferase (UDPGP)

Gene Start:
556435

Gene Stop:
557310

Gene Length:
876

Molecular Weight*:
32500

pI*:
8.48

Net Charge*:
3.79

EC:
2.7.7.9  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Sugar-nucleotide biosynthesis and conversions  

Pathway: pathway table
Carbohydrate Metabolism; Galactose metabolism
Carbohydrate Metabolism; Pentose and glucuronate interconversions
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism
Nucleotide Metabolism; Nucleotide sugars metabolism

Comment:
This enzyme, induced by heat and stress, catalyzes the formation of UDP-glucose.

See Prosite PDOC00638.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to UTP-glucose-1-phosphate uridyltransferases,
e.g. residues 4-279 are 74% similar to GALU_MYCPN. Residues 4-278 are
48% similar to GTAB_BACSU. MG453 is very weakly similar to TP0107 of T.pallidum, a predicted licC protein.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0448 is ehgpcmy.
COG name: Nucleoside-diphosphate-sugar pyrophosphorylases involved in lipopolysaccharide biosynthesis/translation initiation factor eIF2B subunits.
Functional Class: M,J
BeTs to h,g,c,m,y.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 7-56, 73-99, 100-136, 137-262 constitute defined domains of GALU_MYCGE. Residues
8-279 are 26% similar to GLGC_SYNY3. Residues 140-268 are 26% similar to SPSI_BACSU.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 7 to 274 (E-value = 4.3e-14) place MG453 in the NTP_transferase family which is described as Nucleotidyl transferase (PF00483)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
25

PDB Hit:


Gene Protein Sequence:
MKTKIRKAVIPAAGLGVRLLPATKAIPKEMLPLVNKPTIQYIVEEAVKSG
IEQILVIVSSKKTAILDHFDYDLILENALIQKNKLQEHKEIEDIANLAHI
FFVRQKNQDGLGDAILFAESFVGNEDFAVLLGDDVVFSKEPALKQCLEAY
YETNCQTIGVQEVDPCHVDKYGIITPEGDYKNKDLIKVLAMTEKPKPKDA
KSNLAILGRYVLKPSIFKALRSVPYGVGGELQLTDGLNFCLKNENFYARK
FTGTRFDVGTKSGFIKANLFTALNNKDISKKEVLELLNLVKA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACAAAAATAAGAAAAGCAGTTATTCCTGCTGCTGGGTTGGGTGT
TAGGTTACTACCAGCAACAAAAGCAATTCCCAAAGAGATGTTACCATTGG
TAAATAAACCTACTATCCAATACATAGTAGAGGAAGCAGTTAAAAGTGGC
ATTGAACAGATTCTTGTCATTGTTTCATCCAAAAAAACAGCTATATTAGA
TCATTTTGATTATGATCTGATCTTAGAAAATGCCTTAATTCAAAAAAATA
AATTGCAGGAGCATAAAGAGATTGAAGATATTGCTAATTTAGCACATATC
TTTTTTGTTAGACAAAAAAATCAAGATGGTTTGGGAGATGCAATCTTGTT
TGCTGAATCTTTTGTTGGTAATGAAGACTTTGCAGTATTGTTAGGTGATG
ATGTTGTTTTTAGTAAAGAACCTGCTTTAAAACAATGCTTGGAAGCTTAT
TATGAAACTAATTGTCAAACAATCGGTGTACAAGAAGTAGATCCTTGTCA
TGTTGATAAGTATGGAATTATCACCCCTGAAGGTGATTACAAAAATAAAG
ATCTTATTAAGGTTTTAGCAATGACTGAAAAACCTAAACCAAAAGATGCT
AAAAGTAATTTAGCAATCTTAGGGCGATATGTACTCAAACCATCTATTTT
CAAAGCACTTAGAAGTGTACCTTATGGAGTTGGTGGTGAGTTGCAACTAA
CTGATGGTTTAAATTTTTGTTTGAAAAATGAAAACTTTTATGCAAGAAAG
TTTACTGGTACTAGGTTTGATGTTGGCACAAAGAGTGGTTTTATTAAAGC
AAATTTATTTACTGCTTTAAACAATAAAGATATTAGTAAAAAAGAAGTTT
TAGAACTTTTAAATTTAGTTAAAGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy