Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR336 IGR332 IGR338 IGR335 IGR333 IGR340 IGR334 IGR339 IGR331 IGR337 rpsP,rpS16, - MG446 MG441 MG448 trmD, - MG445 MG450 MG440 MG439 tuf, - MG451 MG443 MG447 rpsP,rpS16, - MG446 MG441 MG448 trmD, - MG445 MG450 MG440 MG439 tuf, - MG451 MG443 MG447 rpsP,rpS16, - MG446 MG441 trmD, - MG445 MG450 MG440 MG439 tuf, - MG451 MG443 MG447 rplS,rpL19, - MG444 MG449 MG442 rplS,rpL19, - MG444 MG442 MG448 MG449
* Calculated from Protein Sequence

Gene ID: MG445

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trmD  

Definition:
tRNA (guanine-N1)-methyltransferase

Gene Start:
549903

Gene Stop:
549211

Gene Length:
693

Molecular Weight*:
26432

pI*:
7.42

Net Charge*:
1.02

EC:
2.1.1.31  

Functional Class:
Translation; tRNA modification  

Pathway: pathway table
Miscellaneous enzymes

Comment:
One of several nucleases operating together with the tRNA-modifying
enzymes leading to the formation of mature tRNA.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits
to other tRNA (guanine-N1)-methyltransferases; for example, residues
22-217 are 77% similar to TRMD_MYCPN, tRNA (guanine-N1)-methyltransferase
of Mycoplasma pneumoniae,(AE000019). Residues 1-217 are 49% similar
to tRNA (guanine-N1)-methyltransferase (trmD) of Borrelia burgdorferi,
(AE001170). In addition, residues 1-218 are 43% similar to TP0908, tRNA (guanine-N1)
-methyltransferase of T. pallidum and residues 1-222 are 39% similar
to CT027, tRNA (guanine-N1)-methyltransferase of C. trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0336 is ehgpc--.
COG name: tRNA-(guanine-N1)-methyltransferase.
Functional Class: J
BeTs to -hg-c--.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 17-217 constitute a defined domain of TRMD_MYCGE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 22 to 227 (E-value = 6e-149) place MG445 in the tRNA_m1G_MT family which is described as tRNA (Guanine-1)-methyltransferase (PF01746)

PDB Hit:


Gene Protein Sequence:
VKITVLTLFENTIWPYLNSSIMLQAQKANLVQFEVVNWRNFCNDKHKTVD
DMAYGGGSGMVLKAEPIINCLNFYKAPNSHVVLLSPEGEQFSQNCAKKLT
KYEHLILLSGHYEGFDQRIYKYIDQIVSLGDFVLSGGELVALSVIDATVR
LIKGVINDQSLICESFNDNLLDFPVYTRPYDLKGDKVPEVLLSGDHQKIE
SFRKEQQILKTAKYRPDLYKKYLENKNEKNK

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAAATCACTGTTTTAACACTTTTTGAAAACACTATTTGGCCTTACTT
AAATAGTTCTATTATGTTACAAGCTCAAAAAGCAAATTTAGTTCAATTTG
AAGTAGTAAATTGAAGAAATTTTTGCAATGATAAACATAAAACTGTGGAT
GATATGGCTTATGGTGGAGGAAGTGGCATGGTTTTAAAAGCTGAACCTAT
TATTAATTGTTTAAATTTTTATAAAGCCCCAAATTCTCATGTAGTTTTAC
TCTCCCCAGAAGGTGAACAATTTTCTCAGAATTGTGCTAAAAAACTTACA
AAATACGAACACTTAATTTTGTTATCTGGTCACTATGAAGGTTTTGATCA
AAGAATTTATAAATATATTGATCAAATTGTTTCTTTAGGTGATTTTGTTT
TAAGTGGTGGGGAACTTGTAGCACTAAGTGTTATTGATGCTACTGTTAGA
TTAATTAAAGGAGTTATTAATGATCAGAGTCTTATTTGTGAATCATTCAA
TGATAATCTATTAGATTTTCCTGTTTATACAAGGCCATACGATTTAAAAG
GCGATAAAGTTCCTGAAGTTTTACTTTCAGGAGATCACCAAAAGATTGAA
TCATTTCGTAAAGAACAGCAAATCTTAAAAACTGCAAAATACAGACCTGA
TTTATACAAAAAATACTTAGAAAATAAAAATGAAAAAAATAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy