Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR329 IGR324 IGR325 IGR321 IGR322 IGR326 IGR327 IGR323 IGR328 MG436 MG432 pgm, - MG430 ptsI, - MG429 rpmB,rpL28, - MG426 pyrH, - MG434 MG427 MG428 rrf, - MG435 tsf, - MG433 cdsA, - MG437 deaD_2, - MG425 MG436 MG432 pgm, - MG430 ptsI, - MG429 rpmB,rpL28, - MG426 pyrH, - MG434 MG427 MG428 rrf, - MG435 tsf, - MG433 cdsA, - MG437 deaD_2, - MG425 MG436 MG432 pgm, - MG430 ptsI, - MG429 tpiS,tim,tpiA, - MG431 tpiS,tim,tpiA, - MG431 pyrH, - MG434 MG428 rrf, - MG435 tsf, - MG433 cdsA, - MG437 deaD_2, - MG425 MG427 rpmB,rpL28, - MG426
* Calculated from Protein Sequence

Gene ID: MG431

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tpiS  tim  tpiA  

Definition:
triosephosphate isomerase

Gene Start:
538290

Gene Stop:
537559

Gene Length:
732

Molecular Weight*:
27330

pI*:
6.77

Net Charge*:
-0.42

EC:
5.3.1.1  

Functional Class:
Energy metabolism; Glycolysis and Gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Fructose and mannose metabolism
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Energy Metabolism; Methane metabolism
Metabolism of Complex Lipids; Glycerolipid metabolism

Primary Evidence:
Hutchison III, C. A., S. N. Peterson, S. R. Gill, R. T. Cline, O. White, C. M. Fraser, H. O. Smith, J. C. Venter. 1999. Global transposon mutagenesis and a minimal mycoplasma genome. Science 286:2165-2169.

Comment:
Taken from Prosite PDOC00155. Triosephosphate isomerase (EC 5.3.1.1) (TIM) is the glycolytic enzyme that catalyzes the reversible interconversion of glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. TIM plays an important role in several metabolic pathways and is essential for efficient energy production. It is a dimer of identical subunits, each of which is made up of about 250 amino-acid residues. A glutamic acid residue is involved in the catalytic mechanism.

In B.subtilis this protein is found in an operon containing (in order: pgk, tpi, pgm and eno). See the following gene records for the remaining glycolytic enzymes: UU182 (pgm), UU184 (eno) and UU279 (pgk).

Reference: Mol Gen Genet. 1984;195(1-2):314-20.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits
to triosephosphate isomerase proteins. For example residues 1-244
are 68% similar to TPIS_MYCPN, triosephosphate isomerase of Mycoplasma
pneumoniae,(AE000021). Residues 1-236 are 38% similar to triosephosphate
isomerase of Clostridium acetobutylicum,(AF043386). In addition residues 1-241 are 38% similar to TP0537, triosephosphate
isomerase of T. pallidum and residues 13-239 are 37% similar to CT328,
triosephosphate isomerase of C. trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0149 is ehgpcmy.
COG name: Triosephosphate isomerase.
Functional Class: C
BeTs to e-g-cmy.

Blocks Summary:  Blocks Search
Residues 2-15, 61-114, 192-244, 152-184, and 200-232 represent significant
(100%) hits to blocks BL00171A,B,C,D, Triosephosphate isomerase proteins.

ProDom Summary:  Protein Domain Search
Residues 9-231 constitute a defined domain of TPIS_MYCGE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 2 to 244 (E-value = 7e-71) place MG431 in the TIM family which is described as Triosephosphate isomerase (PF00121)

PDB Hit:
gi|2624735|pdb|1YDV|A Chain A, Triosephosphate Isomerase (Tim) Isomerase, Glycolysis, Gluconeogenesis Mol_id: 1; Molecule: Triosephosphate Isomerase; Chain: A, B; Synonym: Tim; Ec: 5.3.1.1; Engineered: Yes; Biological_unit: Homodimer

Gene Protein Sequence:
MRTRYLIGNWKTNKNLKDAVSFVEQFQQNKLNYNAKIGIAPVYVHLTEIK
KIISDSLLLFAQDANFIESGSYTGTVSFTQLQDIGVNNSIIGHSERRKYY
NETSAVINQKLFACLKASMQVVLCIGEALGQEISFLKTDLTNCLDTIDKS
LIKNLVIAYEPLWAIGTGKTATPEVANQTIKTIREYINDLYDENVANNIS
ILYGGSVDHNNIQKLAIMEQIDGFLVGKASLEIKNFLEMARVYA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGCACAAGGTATTTAATTGGCAATTGGAAAACAAATAAAAATTTAAA
AGACGCAGTTAGTTTTGTTGAACAATTTCAACAAAATAAACTTAATTACA
ATGCCAAAATTGGGATAGCACCTGTTTATGTTCATCTCACTGAAATAAAA
AAAATAATTAGTGATAGTCTCCTTTTATTTGCCCAAGACGCTAACTTTAT
TGAAAGTGGTTCATATACTGGAACTGTAAGCTTTACTCAACTTCAAGACA
TTGGTGTTAACAACAGTATTATTGGTCATTCTGAAAGAAGAAAATACTAT
AACGAAACCAGTGCAGTTATTAATCAAAAGCTCTTTGCTTGTCTAAAAGC
ATCCATGCAAGTAGTTTTATGTATTGGTGAGGCTTTAGGACAAGAGATTA
GCTTTCTTAAAACTGATCTTACTAATTGCTTAGATACGATTGACAAAAGC
TTAATTAAAAATTTAGTTATTGCTTATGAACCTTTGTGAGCAATTGGGAC
AGGTAAAACAGCAACTCCTGAAGTTGCAAATCAAACCATTAAAACCATTA
GGGAATATATTAATGACTTATATGATGAAAATGTTGCTAACAATATCTCA
ATTCTATATGGCGGATCAGTTGATCATAATAATATCCAAAAACTAGCAAT
AATGGAACAAATTGATGGATTTTTAGTTGGTAAAGCATCTTTAGAAATTA
AAAACTTTTTAGAAATGGCTAGGGTATATGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy